SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0064_0055 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0064_0055
Domain Number 1 Region: 579-720
Classification Level Classification E-value
Superfamily Sec7 domain 3.4e-41
Family Sec7 domain 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0064_0055
Sequence length 1513
Comment conserved unknown protein [1514] r:360085-377994
Sequence
MARRDVLCEIQSVLDALRRNARFEIREHRSAAEESRLTADLKALREAVRDWPNEDLRGLS
RLELVSPFLLVVRSPETNGVLTEAALRSLQVFSRDRLIEENSVHASEAVGDLVDALIGCR
FEETQQDHDEAVRARIMHVLAACLEGGAGVWLSDEVVWAVLQTCMANLDQMQQQQQQRER
ERERERAVEPPTTAAAAAAAAAAGQKERGVAPAEASSSSSSSSSSQPQRRRAGAAGGSGG
GGGGGGGCGLPCVVKVFGFLCSQLVRRGGGGGAGASGTASGVSSRGGGASGGPTPRRILC
LRLMRTALAAAGGNLAAYPSLLEMVRDDLCFALLHLMQGSGGVNVVGEVLSIVRYLWGSL
RVHLKVQLELLFGATFLRALSQLKEEGEDDLRQAQEEQGAGGAAGAAAAAAAAAGPGQQQ
QPQPREQFSREAAAGSSGVGAAAARGGRVFRDRELEMTLECLCDFLAEPTFLVEMYVNYD
CDTQRSNLTEMLVAALADGAYAGPDRLSGLDKAAVGAYLGEAGAKRVNGRGGGGGGGSIP
EGTVAVAAVAEAVSPPSKEGGGGGRTLGGVSARGAAAAVYQGDTEEFHAEVLEAFVDTFD
FRGQGILASLRMFLGAFRLPGEAQQIDRILHAFAQRVHRDCVEAARGMLASADVAYLLSF
SVIMLNTDLHNPNIRPEKRMSCGAFVRNNENYGGDISGGHDLPADYLESVYTSIKEQPIA
TSGGGPDDAVTAHGWQDLLRRYGDMNTMAVFSSSNTSSSASGKVEACGGRGVGEEELQEY
DRDVISACWPSVLKAASAAFATMQGRDASALGASVDLFLILAKLCGHHPGLQNAFDKVIL
LLCRFTGLVGPIRPPGRRTNSDSGSSHDDDDGDGDNSDPDAAEGVSAATGTGGVERLISG
NPAARTAAVAAFGIAHRSGDHMREGWLPLLQLIFAMRDLHILPKEALSETGEDLLEHRER
AVFNASVLSGDFCKTAATATAAVTVTTEYRQGVGERNAAHHGRTTAVNPGSEGGEDRFGG
GGSGGDRESTISWVVGRRPAGEEGSRAVQSASAHSSARAGAATLLGGGAETGVGLLDEAG
GREGYGGDQQQQDEEEGVVHPAVELWNETFEKDELSDADGGGSDDGDAERERADGAEDGG
GEEAHKWFFEGPRSEGRDAREGGAADGHRRGPAYGLEWVAQARVQDLVGESRRLGADSLR
ALIHALIAVVHGSLPAHERRRRRGFEGGAGGGRSVGGCGTAAHREGSGGTAAAVATEAAE
NGFHFRRRTTPRVSTASLAYAEVLIAEIALRNRERIVLVLPVLLEHYRRRLAGATYATFS
VEKAATGLLRIVSRLFFRPGLAAPLSRALPWLIPPHCGGGGSGDGGGPGPELFCSLAGHV
SSAMRRLALTAIRRRRRGGGGGGGRRRRVAGGVVGRGGVRRGFGRQGRGGHLRGGVPARP
QPGPQEPPRYRNQRRRRRHLKPCKKKVLLRPPPDGVPRRGGRQRLVAVVVRVATVAAVGR
KAPRQAWSPRARG
Download sequence
Identical sequences D8LRA5
Esi0064_0055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]