SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0065_0090 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0065_0090
Domain Number 1 Region: 312-572,626-668
Classification Level Classification E-value
Superfamily SIS domain 2.67e-54
Family double-SIS domain 0.0000585
Further Details:      
 
Domain Number 2 Region: 85-287
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.97e-47
Family Class II glutamine amidotransferases 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0065_0090
Sequence length 670
Comment conserved unknown protein [671] f:445097-457727
Sequence
MFLGRASSRALARSASAARRRPRTALPRPSLSVQQHPRSTAAAVATAREDRSSGEVSSGS
YMWAAAAAVAALGLASTSDQQAECCGIMGVVSTEHATGNDPASDARALLLEGLAVLRNRG
YDSAGMATSSPDGLMISKYASRGGKTDQNAHPHTDFGSRIALVHNGTINNAHDLRGDLER
KGITFKSETDTEVIAHLVGLELDSDPNMDLKVALAKTVAKLDGTWGLAVIAHEKPDELVV
ACNGSPMVIGLGTDHIYVASETAAFNRHTKNFIAMQDGEIAVITPTECSLDKARMELAPD
HGVESTPDPHAHWTLYEALQQPMAIARALAFGGRMTDSSGVVLGGLDRNMDKLSKIRNLM
FAACGTSLYASQYGAKLMRDMGAVDTCNAQDAAELRVQDIPKSQGGIIAVSQSGETRDTL
KALKAAEMVGIPRLSVVNVVGSAIARETKMGVYLNAGRETAVASTKAFTTLHNKSHCFVL
GKGYGEPVAMEGALKLKEMSYIHAEGYSGGALKHGPFALIEGEDGPEGSTPVIMLILDDE
HAHQMRTAGMEVTVLSLMALWFRQVREAEASNPADVTDMHVMDKSKLMEALQRLPISFGM
AMGVRGKCQKVAQRLLAEGLDDDPIVIPSNDRLTALIGVLPLQLIAYELALLKGINPDTP
RNLAKAVTTD
Download sequence
Identical sequences D7G5I8
Esi0065_0090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]