SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0075_0063 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0075_0063
Domain Number 1 Region: 148-201
Classification Level Classification E-value
Superfamily RING/U-box 1.33e-20
Family RING finger domain, C3HC4 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0075_0063
Sequence length 431
Comment similar to ring finger protein 167 isoform 1 [432] r:397162-400648
Sequence
MATSSKSGRTEKPGNCSTHQISTSFLFNSTLILLGFVWCGVTFARLVCVHRARESALSGA
HFSDRRGGRGDQTGAGFTGTGLGAATSAGPAGLTPAQIRSLEQTNVLPKHRRFGSKLAGG
GGDMDVEKGWGVGGPGKGTEPAAAGEGVEEEATCAICLCEEEDGQDLRVLPCGHFFHAGC
VDVWLAQSPTCPFCKQPVEPPSTESKAGLVGSSAVPVRSLRRWLRNHERGPGAVVAQTAP
PGGPTGGEVEMGSGGATSGVLSEPVVARTSGLVGGGSGGGFGGVDVAADGGDADRPRAAS
QGGGSSSEVVVTLEEEEGEEGEQGQGEPPAAAPPPPPTSTAPGVASLLPVLPPAAVAGHE
ANPAATSPSPGGGAEAFPAAAAAAAAAAGDEQSVGGPTDVHPAAVAAVDVPDPLSVSASR
FEERASASTTA
Download sequence
Identical sequences D7G6J3
Esi0075_0063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]