SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0075_0084 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0075_0084
Domain Number - Region: 347-376
Classification Level Classification E-value
Superfamily RING/U-box 0.000212
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0075_0084
Sequence length 1187
Comment conserved unknown protein [1188] f:512377-520198
Sequence
MRQVPEPSPRSTERVPSPPAPPAPVSVEDSTPRPKAEEEKEDEKEKSADSKKVPGTRPGA
CMVCLEDCDNVLDSAWLHRLAASSSASDVGGTDCTVTACVSCLKTYFTGIVEAGFDGACP
RMRCMCCPRVVCEWVWAPLVEATVLETFQKRAATLLSIQCGMCHSRGTIMVKPPADHCYS
SALDKLMAMIASGLAPATPPSATTATAITTQGSPANIKSSTNGGDNSVASSTCNAQRLEI
FRASLERYISGHEIDPSLCYIALEAAIANPGIGQAAQESRDELMVLLMSCVEDSERRANL
HIRFIRSNPMVVTQCCKSLHCYPCRVVGGHHPQTCEQYEAGRGHQDVCKCPGCGVYVVKG
DGCDSISCICGHDFSWSELVAARHRRIADAFRDAHPEDTGRAAAQIIRRGPPTAADLGAG
PQEDINEHVGARGDIEEQQQQGHEYPLDAPAATAAGTEGGESEQGEDGEEGQPATSGAWG
EPVEHWEPVEDGAWGQRWVPGVEQGPGAADAWQPNQRPAQELERAPLHGTGQATIEEERD
EPVPVPEENGRLSAEDEFRLANAYAEAYPRELARGRAVIYGEENPHFTVQRACAQSSQLP
PLLALSYFHQPCPASTSETEAAWLMRAAEDWRTTNQGEVNAVRRRDEAARSSLVEAFYSG
DDLLRHIAAEYARSALRVAPPFTSVAATDRPRAFWSRLEQYLQQQANGEQNGEPLFKWLG
IVEPPPPTGDQSTWEEGDDGAVADEDAWEVPFADAEIEVETFEVLPPPRRLFTPWPSART
GRVDLRPTPPSSRGRRHALDPASRLVLATSTFGTLNLRAEVELWVAGTNIRQEGLRRLMA
VQERELSKAWVALWSHRRRLDPVSKTWVDADDPGDAAVRAAARRVVFLEAHPEQACQEQG
AMMKAFVRRNGAEVLKAVEEADAELAAAWERMHDNHDDVDASHSSTTPPASTSPSTFDRA
YAAYRKHIDTRASAALVANSLPPTSVASATLQLRRIGRMADAWESANHRRVCAQRFADHF
SGAAGAEKAAQEREALPKRLRESRAAANEDAAAFGAVVALVVAPMLIGRASQMCECDMGA
ILSNAVDWVAFNGEAFEEELQRMEARLRLSPGTMAGKNVKDEGCSGGGMGRILDGCECNL
ESSVSSCSRLVACPIVTRRILRVPEPVCPECEDGSGVFGTDLFDLFA
Download sequence
Identical sequences D7G6K5
Esi0075_0084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]