SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0079_0058 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0079_0058
Domain Number 1 Region: 31-116
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-32
Family RING finger domain, C3HC4 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0079_0058
Sequence length 128
Comment conserved unknown protein [129] r:376748-378334
Sequence
MAAETKGQEPQDVVMGESGKGPEPGIGQVAPRFEIKKWNAVAMWSWDICADTCAICRNSL
NEPSIEYQANPSPNNENGLSIAFGCCGHVFHLDCIQRWLKTRSVCPLCNKEWEFAKIERI
PGYGSLAS
Download sequence
Identical sequences D7G6S7
Esi0079_0058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]