SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0085_0026 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0085_0026
Domain Number 1 Region: 18-103
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.42e-22
Family FHA domain 0.0022
Further Details:      
 
Domain Number 2 Region: 218-274
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000151
Family RING finger domain, C3HC4 0.04
Further Details:      
 
Weak hits

Sequence:  Esi0085_0026
Domain Number - Region: 396-427
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00023
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 
Domain Number - Region: 430-457
Classification Level Classification E-value
Superfamily ARM repeat 0.0575
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0085_0026
Sequence length 459
Comment conserved unknown protein [460] r:152414-156411
Sequence
MASPGAKLVLVASTEDYNVPEIIQLSRESTVLGRSSKTCDVTLDAAPTKTISRKHAEIFC
GKGKRGPKTYTLRDLGSTNGVFVNEFKVQEQRLRHGDVVQFGGAADIPVGTRFGGTGSRI
RYRFEHKLAGSPNTNSKRRRGSNPDAPATNRPKIVRADTLDAADTLRAISNGSSVTRGIG
PDKARAGGGGDTAGGGSVRGTGGAGGVVDGGGGETPSMVMEVLRDAMCGLCSELLLDAAV
LPCSHSFCRLCWAEHVEEKGTTCPVCLRKMHSSERTPRRCSNLDLLITSIIHKLAGPEER
ARWTARQEEAQKRAAVAARKARQQGSNNGPAAPGTRKAGQVPSSAAESKPSPARGVRSTG
SKSNNNGVFPPERSSRGDGNQGGGSTKRLAPSGIAGGGANSSVAAAARCEGCDEEGHEFR
ECPHRSDSALEGSEEEEEEDEEEEEEEDQDEDDENSDDG
Download sequence
Identical sequences D7G7R3
Esi0085_0026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]