SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0087_0024 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0087_0024
Domain Number 1 Region: 609-686,831-1010
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.37e-49
Family Tandem AAA-ATPase domain 0.00043
Further Details:      
 
Domain Number 2 Region: 198-241,301-336,421-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.01e-38
Family Tandem AAA-ATPase domain 0.00061
Further Details:      
 
Domain Number 3 Region: 721-783
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000966
Family RING finger domain, C3HC4 0.0057
Further Details:      
 
Domain Number 4 Region: 374-409
Classification Level Classification E-value
Superfamily SAP domain 0.0000104
Family SAP domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Esi0087_0024
Domain Number - Region: 343-383
Classification Level Classification E-value
Superfamily BLRF2-like 0.00183
Family BLRF2-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0087_0024
Sequence length 1021
Comment conserved unknown protein [1022] f:106806-128316
Sequence
MVHPAPASTATSTAALPAPTASQTEEEDDDATIREVLYGYADLLIVGCRHYRGVAHLGEF
VDLVREPNNPYDRNAIRVDNLTRQQVGHIKATQACILSPILDDRTNGAPRVEASVSVGGT
RVYDLPIRANVFGPPERASATIAALGRLYLKGGMTGRHGSAPGGGSGASGSYKGHAVAVQ
TAISNPVKTQRELDEMFDKLDADSPQLPTANTSANTEPVLLASLMTHQKEGLAWMVQREN
NPDPNGARLDDGKKNNPDSNGKGCQSHSSGLPPFWEQRVEGGKGVFHNTITCSSQPCRPA
SVHGGILSDDMGLGKTLQVISLILAQPPAGTDYVKKVLAVEANKRLKEALDRGETPPPQE
KELTPQQKQEAVAKKYKKLKKADLERELAAKGLDTKGNKNDLVGRLSTHEAGLTPVDPSV
KLGTLVVCPMSVIHNWETQFAEHVKEGALDVYAYHGGNRNQDPTFLATKDVVITTYDTLA
SDFSASGGQKALEEDVTAAVGGKPKRRHGVGGLGGNRVVLDEAHPFRNNKTNKHKACLAL
SSRYRWCLTGTPLINKPEDIGALFSFLHLAPASNPRVFLQAIGRPIRSGSDAGLARLRVL
MKSVCLRRTKSVLSGKLPPKVVEIHRVQMDDGHREAYNTLFNSARAAFKAALADGEAEVM
SQYASVLECLLRLRQVCCAESLVPSGRLETARKVLNQLAKEGPKLGKEEATKLFAKLKGL
LEQDEGAECAICLELVGHADARVLRRCGHGFCSKCLGAMVKAGPPVAGGNRNKCPLCRLE
FSQEDVVSGAELEKAGGASQAAGGEEVAASAVAAAAAAAAAVPGATVVEGKGGGRVPPPK
VAALLQSLHELRRSGNGDKAVVFSQFTSFLDVIQPFLLADGFRLARLDGSMTNKQRQAEL
KRFAGKGGDGAEVMLASLMAAGTGINLTSANHCFIADPWWNASVESQAMDRVHRIGQTKP
VRVVRMVSADSVEDRILEIQEAKEALGKGALRKLKPDEVRKARMTDLRTIFECKTEHAIE
A
Download sequence
Identical sequences D7G848
Esi0087_0024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]