SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0095_0011 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0095_0011
Domain Number 1 Region: 874-956
Classification Level Classification E-value
Superfamily RING/U-box 6.62e-24
Family U-box 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0095_0011
Sequence length 960
Comment conserved unknown protein [961] f:66158-83835
Sequence
MSPEQRLHNSLRAVLRVTLSQAEGETLPSGFVYVGEAVDGDALLAEDILPEVVCARLGAP
DPQDRGIGFLAGAFSRCQDELQSVRRRAGKSDVALALKGLEAARTQLINFSATCLMEACK
SASDPWLAPCAGLTSLLQASKKACDVAVKAKGFALPKEGTPEAAPVPAPVPTGPNALQML
LMQGGARNRMVSPRSGPMAANNTVLGRILRIGFPATDPLATDSFDKVYRRGQPGINSALQ
TVRGRLKVVHSVASGIVMLLVKASVESRKAVVAWFADALLVNTPAEASNPDPLKAASPEF
LMNMSVALLGLAMPIVRDEGKFKKIDAASFLSSKAAIRDLFPDDTTMLVTRTPSSASPSD
SPEEGASSTADEGGSAAAAAVTGEGGAGGVGGGKGVPLVELKSFTTQAFFTCWRALHLGL
LQVMGRHDRLHQQLAHLSREMGDPGSPNPDPQMDMHFNMFVQRKLVAEVVISDPDVLADS
LMFMVKAGSWLTEFVSKEAGVAIDSSEHEISSRGSLAGLSEDSLVWQLPEHLIEDILELI
LFLTNHHPQTLGTSQLYPLMTMVVFFLAHPSLVKSPHLRASLGDVLYKTFLPRSERGNED
PYGAPLGGDAHTGLLYSHPLAQKHLAPSLLLLYGDVEHTGFYEKLTHRFYIAAVLKYLWR
SKEHRSTFRRISQDTGKFVRFANGLMNESNSLVASVMEKLPEVRAVQLQMRDPAQWGAMT
ETQRNEIAERHDENERSLKSNLSLCNETLHMVAYLTSDPDIQKPFLREELLLRLAEMLLC
VLKQLIGSKGLEIKVDNPESYNFRPKEMLREICTTISQFSTQPGFHKHLAMSGYYQEDLL
PKATSTMRRLQLLPASSMADMDSLCSAVIEARASYEASEASLGEVPDEFLDPVLCHVMRD
PVLLPTSGTILDRSTIVQHLLNDSMDPFNRQPLTEDMVEPQTELRERIEEFLARRGSQSG
Download sequence
Identical sequences D8LU34
Esi0095_0011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]