SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0095_0021 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0095_0021
Domain Number 1 Region: 2119-2183
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000942
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0095_0021
Sequence length 2184
Comment similar to Zinc finger protein [2185] f:110522-126872
Sequence
MYALVSACCRHAPGLLRPHPPLPPAKASSGDPAEEGKTEAVSDTGGKKEKANRRDGGGIA
GKRSRVATPGLLAELLSEKEDSNHREAWQAVLLVLREFKETWMAEKGAAAVLPTLLTRLR
KGAFLATSSTSYPCLLPLLASLPAQALLSPADGRAGPPFCVAFVENLWVTIAKPSSGDAA
GDRTGGGGGGGGGGWLADVVSAHVECVTFLLLKLPPAPQGLGEAGDTAAASTSGGIPGGG
GGVDTERSSAAVSVAAATANLAKAVGVFVLEEETGATGPGNGVRTAGRRSQTISEAFGRV
LGQLHLGGEKGAGVMGTTSGSAAVWGALLREFEGGLDQRSRGGAAWMGKTLVHAMTAVNE
RKSGGARGSPGAATVAEETVENPTQPPTTAKGSHCTGLREMCRTLFHHCVGAIGYVSPSS
GVTDDEAGAAISSVDAPLTAFMSSMAGALGMDGIFCMGDAALPGDGGGGDSRPSVVAPDS
AREFYENFLVPRFVASAGGRRSTEAMGEAAMALESLTKAFLLAEEGPRQWNDFRLLLKRA
LAEPEVVRLRTTTMVLRLAPASMARVFPEVDEALLRACGISFPGTEPAAAPPSSSSSSSS
SPRLHPKSSTQDLPAFLQACLGATDGGRERTAAPFVKASTVSEVAKVVTAASPSASTSSS
AGTAEAAGVAIRPTLLPMAVLEGLLGVLGTGESGGPADSSRRGVGNDDDALAAVRKSGLS
LLLAAFSAIGEGRAADRLWRDVAAPTLQDLVLRAPRREAAAAAAAVAETPPPQWCDGIWQ
DFVGEAVEEARRAMEGNGVNDDGASDQGAPPLLLPGRGGVERAATLTSALLDLRSALLRR
GATLLPPDDAPVLWRLGLTRPSVWRQRRLEALAAGERSTGGPLATAAADLARACVGSRWS
RRWECVSLVLGRLPDARARLSLLVEGVVSAEAEGGGVGVAGEALHEILAAGVMVSRAVRL
LGGEEGRGGVSEVSVDLPSCLLVAPAEDTISASGRMARAAAGGVDSVEDFGVGLRRFRGV
SMGADGDDPEAVAAVASAEVLDAALAHLDAAALAGGGGGGGEAGTASWRTACSATVSSGL
VVAVVGEAFARGLGLGDEANRLMAVRCGTYKAPVPSAADLVPGAKTLYTSDGQAVTIVAA
HVDPGGGEGYYTVRPIPAPGGTADDAGRERQTVLGRLSVTPPSPRSSGAVAAPPPHARWL
VRPAVAAKLGEVLAGPVSAIERRLWEHLGRSPEMSGPEAPALSSATAAALRGVASTCVRA
ALLCGSNPRGTAGGGSQEAWEGVRPGILTLRNRWAAAAAKSGSAVLASKTGGGGGGTVQA
AATVALAASVLSGFLAATPLMPSDEEGMRLMPARIRGSLCGEAAGGAGSAAAALGWRRVQ
GTASLAWLRDCAEASCKVHVSASLGSLGSDIFVGTQAETEAAVVALVRSAVRRRRGDNSV
VGGGSFDLALARACAGLFAAESCRLSQGHAASLSCDSKAAVVSWAVSKFLLSGGRMASAT
AAGGTLVSSFGGGDDDAAALCLETARLLTATAWDGLLAARGDRAKVWEAARFPAVWRGLH
AAVVGAVASPVLQLCAFEVLEAAAADWRSDPVSGDEGSEGAKGDDAGTPAGEEEGKGDGS
SATAPGEGQSIVSRLARALGGWGLASAQAGGGAGGGVVDVEGSDGGGGADEGAGSSSPST
EAVEEEAKEQQDDLELIAKCFPEDLLLAVEALPSTIDALAEAPQASARARSGTRREENIM
AAHEEEEEGNYDDSEAEEEDEADEKQAWGSEEGADVDSAERPTSDASAEEEEEEEEEGGS
ERGDAEEHSADSEPEQGGGTADGTDGDIAPQSTASKSRRKRLRRRLSSSSGSTRTTTSDR
GQAGNIPGGGRDRRRTPASGPSLTGPFLTWLLWLEHCRRASELEAKSRSAARVFVARAGA
LSPVMEACFRVLRASQDDGGRSNSGSIGGASRLGPAQAVRVSRLDPRKPHDLARLALAVY
FRTVHVFPALSRSWWSDDCARGLRVWVADFTKRHVSPALIQIEAQIITRATDKGVWDDGG
EMSVRASANSRQVVASYLKEECTLEAVIQLPPDYPLRNVEVTCSKRMGVSESRWRQWVLQ
IVTLLSLQDGSVLDAVMMWKKNVDKEFEGVEPCVICYSVLHPKSMDLPQMTCKTCNNRFH
SSCLYKWFHTSHKNKCPICQQTWA
Download sequence
Identical sequences D8LU39
Esi0095_0021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]