SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0098_0048 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0098_0048
Domain Number 1 Region: 144-171
Classification Level Classification E-value
Superfamily RING/U-box 0.000000662
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0098_0048
Sequence length 173
Comment hypothetical protein [174] r:300452-302038
Sequence
MATTFSGCWPWWPMRRARRSEREAPRGVSRKVKSRFTTVRMPAQVSSAGPAGGGKPHSPC
GGGSGGEEKSSASYAAVGAVAGLETGRDGESSGGKHPSQQKDDGDSQPAAAVAVKVRKGG
LFGVLRRTTVGGGADDDVVHVPAGEICVICMEPFQANDVLEVLLCQHMYHQSS
Download sequence
Identical sequences D7G9G3
Esi0098_0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]