SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0098_0071 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0098_0071
Domain Number 1 Region: 187-240
Classification Level Classification E-value
Superfamily RING/U-box 1.14e-19
Family RING finger domain, C3HC4 0.0038
Further Details:      
 
Weak hits

Sequence:  Esi0098_0071
Domain Number - Region: 239-281
Classification Level Classification E-value
Superfamily UBA-like 0.0765
Family CUE domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0098_0071
Sequence length 642
Comment conserved unknown protein [643] r:439667-446630
Sequence
MERQQALAEAVVRQMDTHELVAIASGRFGSGGGLLSRGRGRASRRFQQAEQTAGVSQETR
MSFVKLSAGKRGLAPAHDVTAPPPPSSAVARLAPSSSSPDDERKSQQAADCSGCAWAGGG
SKSPTLYYERSNPLCRKPCVGVGSSSPSLSSARPRSSKRFFIDGGGGGGDGGAAAAVAAA
AAATRGVYSDNSCSVCLDDYEEGDELLQVTCGHVFHRACIDHWLKAHRVCPCCRTDLDKL
AQVVQLFPQISKRSLQNALTRAEGNIVLAVEFLLTRPGGDGSTPDAGSGGGDSRGDGGRE
AVEVSSSAATAAATEHDDDDGDGDGDDGACRGGGEEAGRGRTAARKPRWGGGYVVSPYSA
MAARGGNPALLRSGGFLQGGGLGRGGGGGGGYGSQATTPRASIDPPLDAEEGGDDVTEEE
AVASTQQQVLETGVARGGSAEGEPECAGGGIRAGEVGAAAGAAAAAVAAAVMAGAGAAGE
TAPRPPSAAAVRTMSARVPTGGMAGAFAWRRRSASLTAAADNEAPKAHGVDDDDACSPSS
QGSGSGSVRQYSSLPSYGRSRSPRGSFLSFSTREGSSVVMEEGGGDGSGSCGSSGCGFGR
LAAANASFPIARTPPTSGSGARGMAAAAAAAVVGDGQGDCMR
Download sequence
Identical sequences D7G9H7
Esi0098_0071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]