SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0100_0096 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0100_0096
Domain Number 1 Region: 304-353
Classification Level Classification E-value
Superfamily RING/U-box 2.38e-18
Family RING finger domain, C3HC4 0.00034
Further Details:      
 
Domain Number 2 Region: 150-235
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-16
Family RING finger domain, C3HC4 0.029
Further Details:      
 
Domain Number 3 Region: 225-292
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000101
Family IBR domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0100_0096
Sequence length 518
Comment ubiquitin-conjugating enzyme E2-binding protein 1 [519] r:508462-514417
Sequence
MEDDQGSDNEYDYEYEDDDIDDDDMAAGGGDSGGGSSASGGGGGAAGGSGKGARGGGGSS
AAEAEVDLALRDDTAVAFIDQAQLKVLMSKVVSDISETVNISAEAATALLRHFSWNRERL
FDQYYTSPESVMEKVGIAAGGHKTGSLKDGEKLECRICCEEFTAKEAYALACKHFFCRGC
WAAYLGAKVQEGPTSVYTTCPEHKCPQIASESTFSEFLSAEDLKRYQAFSLTSFVDINKM
LRFCPGKDCGMVVKAPLSYPRSVRCNCGSVFCFRCGEEAHDPASCEELAMWKEKCQNESE
TANWILANTKQCPKCKTRIEKNQGCNHMSCRQCKAEFCWICMGDWSEHGSSSGGYYKCNK
YEAKEGDGDNDVAKAKAELDRYLHYYKRYQAHDSSQQIAEKQQDATERRMVELQESSAGS
AWIDVQFLKTAMEQLIECRRVLKYTYVMSYYIEEKTPAKELFEHHQENLEKYTERLHELS
ESPLEKIERTNVINYTRCTDRFCKSLLQSVQDGLQGSV
Download sequence
Identical sequences D8LCD0
Esi0100_0096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]