SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0102_0039 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0102_0039
Domain Number 1 Region: 51-109
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000561
Family RING finger domain, C3HC4 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0102_0039
Sequence length 679
Comment conserved unknown protein [680] r:262633-269550
Sequence
MNNGTPPGDAPNNNKRHPALAPFLPKSLITKKIPAPHPEDVERTRKAAADDAKKGELCII
CLEALPDIERGIIACGHTFCFGCIHDWASNRGDSALCPSCRFPFNKIKKTLSPKDIEKEK
LRNERDKNRKNATKKQRNRMRRRAARVKQPVDKIFVKDVRVRKMSKKKQAIEEARTVHPE
AAGGSMNAGQQAMLRARQLAIEAMTVERQAALTASRARREAELRAQHQATLTAARERQRL
AREALAEAQARQAAGTRARLVAAVKARAEQRGASPGVVSEWWDSVAAAAAAPAAAPAPAA
AAPVPATAAAAPAAAPPSGAAATRGPRMRYTVAGFANNSIMGRGRSFASAAEAAAFSASR
ASYAAAAEPVRFSNSSILPISTPRGLAIATATAARSAAAAAAAAAAAAAAAAAQEAERLR
AQRRATERSGRLGEEEEQERSQQREQQQQELSLERTMAAVNAAAARRALASITLEAERLR
AQRRAADRSRRLGEVEEEERSRQREQQQGEARRGGVSNEAAAAAAAEVPSRMDLLARLAG
LEERMPARRAAPGAASLNSSASPSISATARVTRSVTRNTRSSSSSSSASASASASASATA
TEVVRAAPTWGSPRHRVSEAVATWLANAGGGGGGGFPMEQAGVGVTSGQRGNEGGVFVEA
GGARVRRHDVRRHLCRLVC
Download sequence
Identical sequences D7FGW0
Esi0102_0039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]