SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0104_0007 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0104_0007
Domain Number 1 Region: 51-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000839
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0104_0007
Sequence length 368
Comment conserved unknown protein [369] r:55438-59246
Sequence
MTETSSFFPPAGRRDGVAAAPSPSPGEAADPPPSLSKDQRPLAIRASRRQIMAATTCGIC
LETVDDQGFLLRRAACDVLAPACAHAYCFACISIWSERTNTCPLCKERFNAIRHGGGSKS
GIRLAAGEIVEVQERDQAANCSSDEDLAAALAAQESGTSSGEQDDGEAGRVGPHGYISDG
FLVADGAGESEEEEEEEEEEEEGEDEGLWEELYDLRRPERRRSAPSRRQPATTTRRGSGG
GSDDVTGAPRRRSGNPDGRARVGGELRHSPMSSFFGGRGGPAAWAGRGAAERPRRRRRAG
VGDVDGGMLPNELRQLQQEAGRAAAPRPPRGSFATLNATAPRRRDRAQQQQQPALPPMVE
ARQDTYRP
Download sequence
Identical sequences D7FGZ2
Esi0104_0007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]