SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0108_0028 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0108_0028
Domain Number 1 Region: 735-821
Classification Level Classification E-value
Superfamily RING/U-box 1.59e-25
Family U-box 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0108_0028
Sequence length 834
Comment ubiquitination factor E4 [835] f:130342-158078
Sequence
MWGDEDDDAPGGGPISELKNLFRKKGAAALPQGLLDDFIRSTSGDAAGDSGGVTLEELFQ
PLLLSLVNDAAELCSRADPMAAMGEFASVVQALAALVAWKPLAGLFANLPDWVPEAACSG
KSLEKKSPLGILFSFKASRASFEVGTIDLVVCGAEWSRERKATREESQALGSVLKTCRQS
LTTVREALVGLLTTLLKAKQAREQVLQWVGEVANHNRGRERDGFHQGFEVLPLSSEGMLG
NVLWALLRLCEPFLTAGDPKAEALADKTDLDYFRGSDRVSRWLDQRNQSRIAQFEANRAA
LLASASSSSSSPSPGNNPQSTAGAGAGGGEREEEEEKEIDPKSKTFGTTAEFAGLAARLL
HVGIGQRVKQCQTRLEEGALTKLMLQLVDMDPDIVLPSLRFLRFQASRLIKHASIGRGIT
RNAMGEPLPPLPMPPPPRFAMLPAHLMEDVSDMIKFRRVHVPARLPVRANALGAHLPDRG
VRDTVVPRALHWHIRLTGSHTQFYDKFTFRSLTAQLLEHLWTLRPYRESIIRYSQDSAKF
VRFANMLINDSIYHMDEAVKFLSAIKAAQARAADQSLSEEDRAAAREEAEHSGRSAKYCL
KEAKLLLRMLAYMSESIKDAFMVDELRARIAQMLGYFLDHLVGRKSKDLKVENMAEIGWR
PREVLGTLVDVYLSLSACPPFAEAVAGDERSYKREIFLRAADVISKVPSDGSPASEPRVV
EAFRAFADKAEAAFVELSQAAEELGDIPDRFMCPIGCDIMRDPVTLPTSGQIMDRPAITR
HLLSDAQDPYNRKPLTVEMLEPNDALRGEIEEWIRSTPSYRCRSRRGGWRIRWP
Download sequence
Identical sequences D7FHG5
Esi0108_0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]