SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0115_0071 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0115_0071
Domain Number 1 Region: 1175-1224
Classification Level Classification E-value
Superfamily RING/U-box 6.75e-18
Family RING finger domain, C3HC4 0.0039
Further Details:      
 
Weak hits

Sequence:  Esi0115_0071
Domain Number - Region: 248-290
Classification Level Classification E-value
Superfamily E set domains 0.00262
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0115_0071
Sequence length 1372
Comment conserved unknown protein [1373] r:372753-387716
Sequence
MGRALAASVSFGTFCLRAKSTAVAAAEALLPLADEPFTLTEGSALYWVKAADTREGHAAA
CLRNGLDPTPPDIFLPDQTLPALQAAEQAEEAPEGAASSTPRNASSSDAATPPPARPLWS
ENLVTVVANGLGLELERPGGLAGCCVPGMWCGPRGCYTLAFGDTFSNYGGYVGVPPDDYS
IYTCKEPSVPLAAPADSSTPAPAVNGSDPGDAASAPGSTTAALPTLSPTAPAAEVEEKAG
DGSPAPPVRPTIVSVGPEVVKAGEALMVVGSGFGEAVSDVRVMVGGRDCRDPELCHLVCR
PCGEEDRCEFDEMCMEDGLSKEKVCLPICDGTEGSCPCDHRCLPKRFELQGEPHSMVVNL
CRPPDADPNFLCHGSVLREQERIQCTVPVLVWDQAETESSDRAGAGLGQKPPVRRGRHLD
GDGRRGGERVEGRGVVEGEGEEEEEEEEEGGGGELSAASFSLSVGDRGAVWEGSVEYAPR
DCHSAEDCDDGDACSFDACVEGSCVHTGVQEGYGCQAQPVHATWRGDTYRYFQIVDRADP
VEQAEFVAEVRAQNKLSSVTFADDYPVEFHNWREFPVYGTKYEDVYISPNGALFVPPLQT
VVPGGLSAVSPSTEAYFPVLKADWNPSDSRAASSVLVMIEEDQFSVLYQDVFLFKRSASA
TPSTFSTTVFPDGSLRYRYMRIGDKADWTAGVSGNSFVSPTIRNRHVRQSQFIQMDENGL
PSAAAPSEAFSATPTPPPSPGAPASTASNSSDSTSGDDASEVQGEGGGSAVTIIANGDGA
EEEDGDTEVTLCRAPTLACLARACGKAGSEVPVLWEGVGCRAAASLNVTFSCRIGGLEVP
AVSLEGGATASSSGSLAGGFEEEAWGPDWVGGEGGGGLVCEVPRLEWAEAGQDEAVMVPV
EVLWSLPEQASDSAKEQVRLGAAGVGVHGLSVLGDAGLINSHVLAFRYYRDDAEAPDCGC
STSPRQTELTCDSCLVCGGDGSTKDCGGFCHGEASVSPCGECSGGMTGVTGGLWCDEYGE
YLDGPAEAALLSLSQSIMMLVALSIMTAFLTMCLFLARALMLRGVLAMEGDRHGTLRRRA
FSRHRGLSPSELDCLETVEYSTAIDIVSKDKGNDDNSCAADGGGDSSGVELIGEKVSPTS
SRSSSGSEEKGGGVESAGVTGGDDEAFIAQGAEAASSADCAICLGGFEEGDVLRKLPCLH
FFHQKCVDEWLHLSVSCPLCKRSAREGLRRNRRRRRRLRAAAEAAAQRAQQHRDSTVPAT
TATPTRTPTPVGAWFRGLPSSLARLFAHSGDGGGGGGGGEGRGGRRQWQRVDDDGSNGEE
KLDDDRGDTGHDEDSPLDGETRRMRVLNANIAVKRSVRWRGLVYAEAGPRTS
Download sequence
Identical sequences D7FI05
Esi0115_0071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]