SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0122_0042 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0122_0042
Domain Number - Region: 149-186
Classification Level Classification E-value
Superfamily RING/U-box 0.0333
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number - Region: 442-508
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0889
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0122_0042
Sequence length 1000
Comment conserved unknown protein [1001] r:201896-209766
Sequence
MSPPWEPYPERKRKLEERARRHKSKANQQVPGGKQHVGSLERRRNRNPATDSSFSSSSSA
DDHARGADGAVAGYDTDSVATSCGSYRKGLLKSGDSHVRVRPDNCSCLQDGGCGDEDGCC
AEDLPGVEACPCFDRVSTAGILEEKLPVDTCGVCLEDGKLRTCCNRHYCKLCYEGTGNCP
GCHVITVGANRGLLASQKDAADSASAAARAAVATLPGVRDGEECRKCLRQGFARKCCGEF
YCSSCYFQTGHCPSCHVLAEKRIEYQRIPRDPGVVPVLVGFFATVLVCLVTLAGVSVAIA
SNSAVIKTVFDQTCYGFFPSCTPGPKCVAYDSGDIGNGLEPITEWSACEDETTVNKIYGS
FCVFDEEVYVYSDEKWGFDFCEEEFMSGSAGAYVFEDTFEMWDAENLSSNTMASARWDHV
TNGRLSDVCGLGNGAGTMMFSGANFREVETLDVDMRYGGKVLFLMKMGPTVPDASAVLCK
PAYGGNVYLYYSLDGGGVWETLSILETFAYRKEAFTEVEVDVPSTLNAASVRFRWKQENF
ENALEYWALDDVRVLSYFAEGWRETAAFESTVDVEHETLREIRCCLNSEQCDLSKNRQEA
VDCAAYITETLNERALLGAELFVLLAGLVTLARSLYRTGEGMVLEGWEYAIPVFLRKKRA
KIFMADDPVPGSMNKVFRLEVNLRWQTRFVALVGVPLGICWLYCATLLRNFYLVEELTLL
PDVSPQSVRVKVHVSGLFILATFIDVHSVFLLARDVVCVLPLWLPKVDVDLRPSAGWLRI
GTQQISLKDIKDTEMFSRRFCLWLAAGYIAGVMPWCLVSLILKYSYIPYAVARYVTVSLG
TVVLARAWLGPEWVVKTAYSVRWLLTMDILRRDDIGNAFIAEKTKHLVVCCAVFGTLLTM
VVLQLFNTRFFAIISAVALAMFAFYGLGLSVVQGLPITPRFHLTTISRGVMLRVHRRVVC
PCERRLEQCGGMHSRDELVCVFVRDALTFNEMLRGDDTVD
Download sequence
Identical sequences D7FIM3
Esi0122_0042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]