SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0125_0077 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0125_0077
Domain Number 1 Region: 438-492
Classification Level Classification E-value
Superfamily RING/U-box 1.64e-18
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0125_0077
Sequence length 511
Comment conserved unknown protein [512] f:410139-416558
Sequence
MDRRGLLLCCYITTSRRRPQPHIRKAMEMEECWDTDTEVDEVNDDNIGPLLAAQPDLPTT
AAATATAAVPSPSERAAAACLPHATGAHEQQQPPQQVPSGGRRSAASSSSATGPTGGTGG
IPRTPNSDANGATLARLVSTWGPVTSQDGWRQAAAAAAASPASMGGVGSGVVGQVRRGFR
DGFSSSSSETSAHRGVPQGGAARGDRVGGTRASTTNRNSGGGGAQDGDRGRDHLEDVSEG
GGGSNGLLAVGLPSGLSLGLGGGAEASLTGMSNNSGGGGGGVGEPSSSGSSDSSNEDSSP
GGVETNPPEELLRALVGARITIALLLLLMCHYIVTHLLGIAAFSMGTAIVVVLDQRLWSH
SGAQRRVNAVVEMAFVLYRCLLPAPVWLEFYGKDSDYFAGIYLVLKGMQVSFRADRFVRA
ACYVRRGELDRGKLATPEEVAEAGSPDCSICYDRMSRPLLLPCNHLFCGECVAEWLERER
TCPLCRAEVPSSNPIPRSLRDGRTTVVPQIL
Download sequence
Identical sequences D7FJ26
Esi0125_0077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]