SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0126_0037 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0126_0037
Domain Number 1 Region: 994-1038
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000265
Family B-box zinc-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 968-998
Classification Level Classification E-value
Superfamily WW domain 0.0000356
Family WW domain 0.0054
Further Details:      
 
Weak hits

Sequence:  Esi0126_0037
Domain Number - Region: 1096-1130
Classification Level Classification E-value
Superfamily WW domain 0.000789
Family WW domain 0.004
Further Details:      
 
Domain Number - Region: 929-961
Classification Level Classification E-value
Superfamily WW domain 0.00135
Family WW domain 0.0042
Further Details:      
 
Domain Number - Region: 1047-1092
Classification Level Classification E-value
Superfamily RING/U-box 0.00152
Family ZZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0126_0037
Sequence length 1254
Comment conserved unknown protein [1255] r:172644-190764
Sequence
MAAYSNNNLAPPILPTSAAATKKETMAVKKNGAKRTVGGGSGAGGNKQARSSTRVGAGLS
EDVPGGGGTTCWRQGASNSAVARAAAKAAERMTKLEALMNAAMESPVTYEEQVRRERLAH
LRVMYTVERDMAELPVDFLRGVGYEDYGIKPRLSRMCAALGKSHRWSKTVALSRWARALE
KARADEFAEDMLRYEHARLFATLSSIRKRWELKQARRRFLGWRKRVRLARLAEDEHRARV
GAIKIQRWARRRLAARRRRRALEQRERRRNALARDKADAVAGVLSFEDNRRETLWRTLRL
VDEKRRYEANHRAATALQDAWLRHVGRCQLLEYAEMERQELHRRRLAEQARRWVVILPMA
RGFLSACLDRSQRAVIAKLRARHETLRLAHEAELAEHRRVLNAAHAVIAHAWRGKSSRLE
FLARMKALVDVQRAWKRAAGRRRLQAEIDDRVVATAQRIKKARESAASRLQAFARKSAQR
HQLSKRFAARKAKLDFERRNRSELASACLVMFKPSRAIREAAGREDFEAMGDAVRPAEVV
ARLRASAAARGVSLSQIMSGAFDDDDDDGDHEGGVGEDGAPKRLSGSELARAVLKQQESQ
RRAAEAVQHAWRKRKAMLHLEGLFAKRKVQILNDRRELSAFRLQRVWASARLRVELAARV
EATRRRIAAERDWGARMLQRLCRRRKDAKELASRFAIRKIILEQARSLREMNAAVSKIQL
WYRRRQGVYYTTLRIVARYQLAYKRDVLAREEYLRRREEAAVAVQLAWRRRSMRVYLSRR
FEGRRARIALAKKAAEREAAAKVLQGWWRRRQARVMLRGRFAKRARLMVKKAEEEERARL
EDGAARLLQKTWTRHCEWEKMRLRFCLRRKVLDETFALEESKRLELEQLEHEKREEEKRL
QREHEATKVKLLLEETEKKRKADEAADYLLKAWKLGYDQDNARNYWFNHVTGESSLERPE
GWVILPSERWKKQTNDKGLAYYLDLETGKTHWFPPCEQCYKREGEKVCMDCEEQVYCGRC
WTMAHKEEHMAGHVWKGADSGKEDLSPGERHCVDCGFRKAKWVCLQCKDALCGECNARIH
GSGHRKNHQVETYAKSKKGWQTVEGRTDNEPTYYFNASTGESTFDKPQDLMLPEELVEHL
RFLKYKETSEKYVQKIEKLQFQLEELMYEKDKIAYQWANAQKDMKADHGTGGGLSLSGLK
FGGSDKKSKKKAAAEDPRTREQEEGYKKSLLLSRKDKKDMGFEVKLKKETVLDS
Download sequence
Identical sequences D8LDT6
Esi0126_0037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]