SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0127_0019 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0127_0019
Domain Number - Region: 45-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00486
Family U-box 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0127_0019
Sequence length 334
Comment conserved unknown protein [335] r:63989-67655
Sequence
MGGDGGVIAAKREYMQSCGDVFGMKGGMAKTALNRTETAELRTKVCAISNEVLREPVAAC
ELGYLYNKDVLISGLLNRDLNPAFNHIRGLKDIVECKLTPNPSFEKEDRAFDGPEPARFM
CPVTLQEMNGSHAFVVLMSTGWVMSEKATKEVGIAGLQEEYGPFTEDDIVGLAPTDEERE
TRTRQLITKREKARLAKKSSKKSARREKTAASAKAGATKSSSSPPSAGAGVIGEQPSKPS
ASTGDEAQEDAAGGESKKGKKRRRALEKEAASAAAVAANGASAGPNSARLAGAAAEAVKK
NKEASKVYASLFGKKDVSNEHLFIATAGHRYNLG
Download sequence
Identical sequences D7FJ42
Esi0127_0019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]