SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0130_0017 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0130_0017
Domain Number 1 Region: 777-829
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000707
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0130_0017
Sequence length 969
Comment conserved unknown protein [970] f:63548-73454
Sequence
MATTTRAATTILPLELGDISDERREQLELRRQREMARQQESRSGTGSFRWSPIAMIPAHL
CVLVFLVFLLEKLEGGIGWPWAAVLSPLWITDAVFIVIKSKELRKILRTTVHVPSETYAL
FPPLGGIIDHLGVAAAKVTLAYRLEGKVDWSLLLLFTPMWACVLLAGTLRCITPPHPQVI
AEHASLHRAGAFFTGLFHLVARGAQPVLIVLKVDGQLEGPWSSVFIPLWMFMGAIALGGS
ALCCCAPTVSRGVIPEIRPLLIRGMLLCSVGTFSLAFCALLFLVFLTLELDNNENFSPRT
ILAPLIALYALILVFLPLLLLVTRHYVRTMRTAEEQFRQANDPNGGGGMDASSTAFGGVD
DVEAGRGVRGSPPIGGAEEEEGAGTGPEGGRRRRRRGSSVMAPTILMRESSMLFRRASAS
FCRRLGEADGSLMNPDVTAFEVRFRAVELADWGRRGGRFRSRDSDIAAIDDGGGSEERGE
RVPQRSSRSFHVLQDCFPHARGAVRRGGQRFTAAVTGSSSREGHERFSVSSGRQLAGAEK
EGSPRPRGEDGATSKRTPEDDRHDQCLLPGDSGTHSVTDSYDLNSFGSFVDSDEDSHEVG
LSIDGDEEDEPRDGGGGGGAIDGSSFHESLPATTTEPPEILLGFGSAHGAAAFSLHGGSG
SGHGLCHGSAAAAGAGAWAGAGAGGGGLATSRHRWSAERGTSSRRGAGSSIHGGAGGMPR
RLSWPGELSLASVGGDEVDVAAVTASDAEAGRGGVATGGSSGPLAAAAAAAAPSRREHST
CYICCERRADAVMMECGHGGVCFTCATTLADSPPHLCPVCRKVIQEVFKLHEIREFGRVV
VVPPASGGEVAVATAATAATPRRGGIGGELKVPESEGDPPTASNAAVGAAGLLTPSTSVP
APPSASASSMPVPGGVYVQRSGDAPAGVASSTARRGFSPSGPVSSPESGPRNTLEAQGMC
DESNWLDPV
Download sequence
Identical sequences D7FJ86
Esi0130_0017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]