SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0159_0026 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0159_0026
Domain Number 1 Region: 10-212
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.62e-56
Family Ankyrin repeat 0.0000754
Further Details:      
 
Domain Number 2 Region: 294-334
Classification Level Classification E-value
Superfamily RING/U-box 0.00000435
Family RING finger domain, C3HC4 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0159_0026
Sequence length 794
Comment Ankyrin [795] r:147378-152374
Sequence
MALKLNSDAVRHAVKDGDVDAVREYLESGVEANLANPNTGRTLLHIACRQGYSAIASLLL
SNGANPGATTLRQLTPLHLACHQGHLKVARLVLEAWAPVDDRDETGATPLHLSAQQGHTD
VVRLLLQCGADKDAMDQSGWTPVFFASWNGHAEVARMLLQAGANARVSDLRDNITALHLA
CCWGQLEVAKVLLEYGADSSAKDCNGSFPDHVIGAGSPDSVDPACAHELSEVVVGHRRRI
KGASSSLECVVDSLRSKVSHLEDQLERAERERLEVMAYSSDESRATFSAAVKPECPVCQV
EVKEAVLDPCRHLAACASCANSLQSCPLCNCPVRGYRLLESRQVYERVSALEDESAGMRA
QLKRFSRRVRDLVAENADLKLDVRRTRAEILVVTAERRGLEERFLLRTPSPAPTPPVVES
GSIAAGSSVASFEGGGTEKPRGRFTLTSENSTGTSGACDDGIHRMQGPGVVFSGGGSSAA
SLDEPELAVLDRPRPADGSYVSGRPASGEGKGQTAGSSKSSCSELIAEGANSSGNGDPSK
TTTTVESGARVDASEGGDGQDAERCFFPDRTVGDGDATPTPREATCGTDNRKYERQEELH
ACTLGTLAELKDGAGGGGKISTALGTVQAASGSAADDPLDLETACLNETTADSHLDLETV
RVNKSVADNHLDHETVRLKESDCAAFSRSVRPTRACSVSVKIVGGACTDCSDTTAETTHP
ANLPGALLLAGDVVEEETNSRSSPMNVSNSGNQVVERDTNSVSDDGDWSISTNICGDKSG
AWPSSSFILAQSQR
Download sequence
Identical sequences D7FLD3
Esi0159_0026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]