SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0166_0034 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0166_0034
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000106
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  Esi0166_0034
Domain Number - Region: 394-444
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0748
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0166_0034
Sequence length 459
Comment conserved unknown protein [460] f:206917-208510
Sequence
MVKDCVVTPCGHSFCRSCAGDAVTRKHCCPVCQVGVIGGEAGLIRNFLVDEVTSTLRRAT
EDTDVAYMRLLFDTAAGGTAGAGAAQGKGKDDDRDHPHVGSDDARFPIGFPPKPPFSAGN
FRGETQPVEQNQPPLPRGVPPSPAGLSPVEEVLVRRMREAFLGYQSYYARERAAHAAEVS
DLTAQLSAVRREETTPCQGQAETRARRAAALQGAIQESEARFNAGMEALLRDFDAHAAAA
LPPPSLLPCTVTLIVASRGVRFDTQLLPTHFPENIYGKVRAHYAASGDEVRGFGSTTRLY
LQPLSATRRAGTGVGAAAAGGNGDGSNSAAVAAEGQVHPLSDATQTVFSQSPGGRVGAGW
ALVVDGPVLLKSEEIKPCFAVEFAQQQQQQQQEQRVDYFSCGACKLNWLCASCAAHCHGG
CGDVKPFMLNHLPNWACCYCSKKRSKLECKLAAVGGKAN
Download sequence
Identical sequences D7FMB3
Esi0166_0034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]