SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0175_0039 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0175_0039
Domain Number - Region: 845-893
Classification Level Classification E-value
Superfamily RING/U-box 0.000577
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0175_0039
Sequence length 899
Comment Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse), isoform CRA_c [900] r:200948-211516
Sequence
MQEAQVDAFTSGEHEMSPISGWMWRGRKGSGVAKGVKGLGMLQHLRDSRLIPYRLGCNCL
YDHPALKHLLSGRENGSSPDAFPRLMHINPSMAGPVILRRREKGVVPGAVAFAGAEFVVV
GKTVVGVEEVWEVVSELSEFFASQFSEDFDESPPPSPPGLEGVPEFHTKHGTARSTLFVP
ATSEGMLTLLEGQAPGDIDRFKAWHMDPEFHTISHHVWCLEDLRIFLFLHRLLFVFWVVP
FTVQQLSGLLRIIVLCGYLVMLACRLPAHEDWLYEYYRSRVGQAVVAVMRVLLVVCCVVR
KVLKVASMLARELVTQMMTLPGLILGEKGVVIMMAIVLVVMEVTHLVAGIVYTLYRAGVD
LTIACLPRVPWLASSVRFADAALGYLLNLVVVLFLGSVSLVLWWYSPPKEAPSVQTEKRY
RELLEKTDPESKEELAKLVKELISNLRHQNEMAMERRRNIKTKGARDCFGGRRVCAHACS
GALAVAAVKLKRKASSQEMAHIKLILAKSGVIRDSLVRTARFLLATDPTKAVAEVSHELF
HAAYDGLIWPDEPLIGKALQSEGRDPTAENINWHRAKWVAVAAELIVDQEHTSWFKVPPG
STKEGGDTFRNSGVHPAERCVHCYTPQEGSNSSAAAAAGTRHRCMKTEGRKPSARFSACR
SAVVKQSKRHKVLPRFELAEEKCCVIPADSESFTGMAAEYPYFHVEARRPGVDDSERSRR
LAVRVRSLDEKFDWLVSLDKEMAEAKAAARRPASGPQDGEPNAKDQEEDDKTTRERKAAQ
ERKARRVKARKERAKEAEAVRLQRLKELEELIAAEEKEDGDGSAEGDSATEEAEEEEEEE
DEASLCIVCMAEKRNACLVHGKTAHLVVCLPCGKRLKKANMGCPICKRRIDVVIESFTS
Download sequence
Identical sequences D7FN63
Esi0175_0039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]