SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0176_0009 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0176_0009
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000404
Family Ankyrin repeat 0.003
Further Details:      
 
Domain Number 2 Region: 228-300
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000294
Family U-box 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0176_0009
Sequence length 381
Comment conserved unknown protein [382] r:63818-67947
Sequence
MLLENESDKDQPNGMGWTPLHEACYFNHLDTVQLLLVHGADPTIKNVQGAMPYNMTSFQP
IRDLLREIGGEEAAKTMPTPTFSVCVNEQGQMFVRVTAGEADKEEEKAGGGGRGSAGGAA
AKKASSPSRSRSPQGRAGSGGGGPEGGEVLHKGPMLGELPALGRPPVSSSSGGASPTAYD
SKRDSEERRHDGAGVGGRGGGGAGDGAGGGPGMHEASRDSNSLGMPGETDEGQAPEGIIC
QLSKRVARDPVRTPYGHLFDRQMIGLWLSKQGSICPLTGQPLVEAELKADGKAKAEAKAW
NDDLLAQKKHSATAASEGRGGSSSAAAANGAEGHSSSSGGERNGADLETPAPAKGAAAAA
AGRERRGSKEAENNGDDIYDF
Download sequence
Identical sequences D8LGQ2
Esi0176_0009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]