SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0187_0010 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0187_0010
Domain Number 1 Region: 318-503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-18
Family Tandem AAA-ATPase domain 0.0025
Further Details:      
 
Domain Number 2 Region: 147-240
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000144
Family Bromodomain 0.002
Further Details:      
 
Domain Number 3 Region: 617-662
Classification Level Classification E-value
Superfamily RING/U-box 0.0000155
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Weak hits

Sequence:  Esi0187_0010
Domain Number - Region: 88-114
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00613
Family Tandem AAA-ATPase domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0187_0010
Sequence length 674
Comment conserved unknown protein [675] f:47424-58257
Sequence
MRHRERGRAARPHPEFVPVDIAAVLPAGGRENSSVPEGSNIGVASGGGGWEKGARPDVSL
PSPTASGRLWINVVDGMVWPSAPAPCSEVRGGMLCDEPGLGKTITVLALLLRTRGLLPGA
VPLPLGVSSSTRSGGVSAEEQWRNWGSLERQGAMMKVVRALQISDRAGMFSRVLDEETLE
ELGMPDYVAVVGEPIDLQTIARRACSRGPRDSVPSYDTFRDFASDVRKVFSNAIAYHSGG
AGGAGAAVSERSSGGGGGEGGDTSVRQAQPPAGRDRAMPKVAEAAEELSREAEDLLKGVF
VARRIDRAESLLERLCALKASSATLIVVPPPMLPHWRNQLTLHAEHGRLGSVFFDERSDT
RLPPVDELKDFGVVVTTYQRLTNEQPGWSDSPLSRIHWLRMVLDEGHAMGTSAMTSCGDV
ARRIEAERRWVMTGTPTPTTSADAALRNLSNLLNLLREKEYSPEWRRNVRGPFIANKPEG
RERLRRLLSEVMIRHTKADLLSIPPPVRESALLNMSQQETLAYDTIVSFVRSNLLLTSME
GKTSGWQDSLLNPANTKYAMEALTNIRLSCCGGGTLIPMVKGIHQVETLHMLRDLHDASA
VDLRRIDNFITRATMGEVSSCQGCGEPLQLLHITPCTHLICVDCVDCVNNTCRVCGSRYD
IDDFQVRTIDECNA
Download sequence
Identical sequences D7FP67
Esi0187_0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]