SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0187_0030 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0187_0030
Domain Number 1 Region: 481-529
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000441
Family RING finger domain, C3HC4 0.0022
Further Details:      
 
Weak hits

Sequence:  Esi0187_0030
Domain Number - Region: 407-436
Classification Level Classification E-value
Superfamily RING/U-box 0.0953
Family IBR domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0187_0030
Sequence length 558
Comment conserved unknown protein [559] r:172391-177138
Sequence
MANSWINRTPSGLPLCPTCNKELGFCPHSPTLREGARAGDKEETGAAHSAHTGSGEAVPD
TGAVPLALRINEAGQSHESASPEERPKHGTKRRPSTALQGKGKQRRVLVQSKGTPALSAP
DEEDGVRIRRNPPRSTRTREEECKTRPKKRASLASSGDGGGGSGATNDAAVDEKTRLLRF
PGFEANGTGQQCISCYEVAPIMVNFACEGRREQEAEKARAAAERQQGSSRESTGAGAEAV
NTAVASRLGMDVPHVMCVDCFCVYVESRVSERMLVTSRDFDGYTVGCPMGCADSFIDPSC
FEEVMGAEFMVKYRRFAAIHLASHLRVVWCPGCHCGVVPSAAAAAAAGARRSSVNPLPNL
QQEQMGAARSGVSSLWGVWGGGRGAARSGAERQEEEGGDGTAARPRGSFCIGCPGCQASL
CMLCRELHAPGVSCADAAAGAAVAEEKNDEEGGSCGGGGGGEGSGAARRASTGSQKDEEE
LDDSPTKRCPGCHVPIFKDGGCNHMKCSRCHFEFCWLHLTEWVEGGECQRGHWSSNPALN
RAYNAQRMARERQRCTIS
Download sequence
Identical sequences D7FP82
Esi0187_0030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]