SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0212_0016 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0212_0016
Domain Number 1 Region: 27-225
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.52e-18
Family WD40-repeat 0.014
Further Details:      
 
Weak hits

Sequence:  Esi0212_0016
Domain Number - Region: 1197-1240
Classification Level Classification E-value
Superfamily RING/U-box 0.0706
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0212_0016
Sequence length 1246
Comment conserved unknown protein [1247] r:54486-68715
Sequence
MEAAFDFPLGSYSALNKTFTKLHVEVGGRAAAVGNNKSLLVFNLEEPVAKGAHALCQDGD
DLQKRGIVYRYKDEAKRLFAIRFNPHHNRRMHLASAKGQLVHIWNLEDKDDASGSTRGVT
TLRQMTTANVMDICWSRFDENLLAAGDYLWDTRNANLVQAWKVPGGDSRVLTTQVSFNRK
NPYLLASSQVNQVYIWDMRKGQKPIDTIPVSLPSEHVTSLDWSSESLDAAGHLRLHNVEK
LDFESPGKDLPAGDSSGGRDYGSTAGSESLETSATSKAPVIRKEILPVVWSLSEPQNAAP
FKMAIETTSDIPVRELVQVENIARRGGFGSVRGVDLQVARKCISLVMAATAEATRPPSAH
EAEALAIRDRRDREPGTEDAPHTPGRTYLVNSWLRVTARVQPAHWSREANAIVDLAAEQG
PVFSAPHDLATVVCEDPLDEATVKRVQAAAEEVMHQPLKTGKSRLEACLARVRRDLDACV
RDAANQAAGVVEGDESLSQRGLQNGVDGSAEGMLANPESRASLSDDENIPCPRRFGATFA
ANGTLVVFCSSTKAVRAGRKHAEGNSQQVYTYPRTYGCFKKSLDEALDNDGDETSRGGAS
QQPHRSLVADNGHSWFRPAWGDELDDASEYHDDDTYDLDRSSTEEVFVEEDSEASKSDAA
ITDTTRLPISHPDHSLGAGLGPPSERDGDERQSEDDPAGAADMDVEGELPWTPKFDKVFL
LDCTGFLPGSPFLAAFYKLGPVRQAAAHVQSTVTSPFSSGERDRRQEKGEQPYFVQCSDT
SVSSGGRSRRNSLMSGLGISSGMPPPISVPQRGPSATLENTVRSGGPGRRPSMDGGQVSE
LEHVAELPLDGPSVNVTPPRAIPGAGGESGVLSPGATMKPSSAHGHRTRQRLGKRRQHQQ
FARSPASSVDFDALYLRLGTLAPTSPADTVGPASTSPPMSDFGMDLGQSSASHGQATVNR
SRSFSAGTSLLFGERVGDGQLAAQLGLSGRGHHSSTDSPTAFHAAGVGVRPRSLRGDPSS
CMAIAEEDKVEIPTVGQLCRHNVRVAAARNCAELASVWALLAEAAARGESARRENSGLGS
LLDARRLPRWETSSSLLTSRILTHHESCADPQTLASVASVVGSGSRDGGCAGGLPQGGDH
TASCDRYIESYAERCCQWGAEGERAETVSHQTEPCDHPASGVQHVGARHPHDTANPVCSV
CGTLVRGRPLLCPRCGHGGHSKHIAEWFELERECPACDCRCWEEIC
Download sequence
Identical sequences D7FRA1
Esi0212_0016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]