SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0215_0039 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0215_0039
Domain Number 1 Region: 211-261
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000606
Family RING finger domain, C3HC4 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0215_0039
Sequence length 897
Comment conserved unknown protein [898] f:238605-245615
Sequence
MSKEQFLQANFHFLLHNPAWSATTTTGDARSASPGLQEAFFDPDVLVDWDTVDTVRLFRR
VSRRKQAVSPPPAVKVKPNPTPPATGTPPPPQGTSDASGCLSGAATAAAPKEEGGPAERE
GVPPGFKGLTVLRAAAEEGVSWGSTSSSSGKKPTAAAAAAAAAATAAREASAAAESPLAL
AMSDGVQSRVASPSGDGAADDDGTQEDETGEEGDWTCPICLGVPVAPRVTKCGHGPFCLV
CILRHLDGEASARCPLCFDKMQRNQLRRAACQDVRPYVPGGTASLLLLRRKRSSLVPVQS
ASDKGTASGVPGGATASIPGGGSGGGGAVDEGWAAAGGVCPAEGDGSERFSRLVRAAPST
LRDLAAAEQMALLSFRHSSIASGETEWVPYISQAQALVKAQLDRFAGVPPTTITAKTATS
GLKPQERTAVGRGGLVASGSPAVDATPPGTKSISAETPPHGGGGGVSGGGRRVDSAQRVE
ADSSSPVGLENGAGTTVGRGSGGSSSGSLVVAPEAAQPSAKGSSSSDKPSLGTRSSSAAA
GAHGGGGGGGGEGGGGPFRFFQSVDGQKAFLHPLDMRQLLEDAERGLPLPPRIDAKVLEV
ETVKLTPELRKRLPFLGHLPIHCDISFLEVDMLDLVSDETSRKFREDTQKRERKRRSRVA
QEARLKKEEARLERDRADRIAAMRAFTVDLQGPTPGGAEEPPRQSPPPPPSNPNASSSEG
SGDGAADSVHHAATTIVVGGGDASSAPSSSAGLGGVATDETAVAAGVSSAGAGGWSFARV
TAMNGHFPTLKPDAGSSGSGSVGNNAAAGAWGGAASVTSTGSVPVGGSSAGGVWGGRGNG
LLSSGAAALPTTAVRENRVVVVEGEGAAGPGGGGKKKGRKGKAVSLFSNAGVRGGSR
Download sequence
Identical sequences D7FRK0
Esi0215_0039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]