SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0227_0009 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0227_0009
Domain Number - Region: 295-327
Classification Level Classification E-value
Superfamily RING/U-box 0.0883
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0227_0009
Sequence length 335
Comment hypothetical protein [336] r:53552-55263
Sequence
MGGSNKLPRDSTPARQQQLQQASESVAPTVGRQQLLKARQLLLSRDRAGAQRAYTLALHQ
AQSSQQFDLAACFLCHLRLAQLCFSPADRGRGASRSSNNSCGAPSVHVSAREHLEAAWAL
RDIVLRYRLVPPLGALGFYFRAVGLQLAGLLGEGSQRRRGGGGDGGSNSARDDDAEAVLR
SLEELGLLESVCAGEVQDSSACDGEMEGSCRGGNAREAPATRGVKLGGSPQGARIDMDGL
CDGCGKSTKRGEAAPPLPPPPSRETDGGRGGGYCPDCTAAYDKAVAQGPKSDDTPCAGCD
DKTQPVAIEPDGKWYCEACIQEFYEEEEEEEEGET
Download sequence
Identical sequences D7FS29
Esi0227_0009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]