SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0254_0038 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0254_0038
Domain Number 1 Region: 2355-2406
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000982
Family RING finger domain, C3HC4 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0254_0038
Sequence length 2424
Comment conserved unknown protein [2425] r:187090-216285
Sequence
MLSSVPTELQGYETLLSALGVPKEFSPDNFVQVLCGMEAQSRGRPLDSDTLATAVARSRG
SGEHQAGVGVAARQGGALPLARLEPGLRRRPAAKSLGVRGLREAFLSSQGGTQSMPCPIA
REIGELLNLSPGNAAAAAAAGATTDAAGSGGKVSGAGSSTKSRSPPGSRWLHDVLEVAET
MKAERVEIILDEKEYEEQSLLHPALADIQGPSVCVVLPGTVVTDKQLTMMLSSPVKPAGG
VAGDLGVGGGSMGRPRMGNSVTALFALTDCLQVLSHDSLFLFDPCGEYLFSGADPPTLPS
ADGGPPSQHTKQSGSASATSSSAAAPRSRRSSSSSSRGSSPSSSFFVKNNASPGSSNAAA
AAAAAGQPAPRPRSAFSSSAGAAANRLPVTGIGGGGGRHHSGGPRRDPIGRSYVVRREDV
LNQFPHQYAPFLALSGGIRETIGEGLTSGRGYHGTVFPMSLKTRPGEISGSKCTIHALER
ETMPHAKSYSEGLGLRHPRPHLKKHGVRELKRFSGPASAGLVMSHHLKSVHASVRRRRAG
GGGGGGGGGGGGGGSSDGVEQLFSSRLRGVNSPAAGRMLGVGGRMKRRGAVSNTDWRKSS
LNVYIRGFPAPRGCYKLSVCTSSWRDERRDDDNKFNKAAAGGGGGGGWAEGERSRRRMEE
VEDMWVLSYVLAPPEARKLALSAEFEGEGLTPLMTCASLVHRSITVDGQRRAQETPAVRG
RIFIGQDSSVLTGLPFHIDGPFFVSRRGGKASFVMDSLEDNRASLPPRAPRVAHGKWNKE
LFGSVCTELVPEHMVDLKDELSGRDAGLLYRFWPSAKRAKRPFSIMLPGQMYLQLGDLPL
YLSRSASEGGFKRMKDGYFKTQAVSPLVEEYIRRHVNLFSVPHTVTEDLARQPTVTVKKI
TPASVREFLRRSNGVSSQGDLGRVVDFFGGGGGGVGNNGGGRGAASATGGGGSGGGGGQQ
RSGVGPAPPPDTELLLELLEFCLSDCRPPEGERPSGVPAGRAGVEAEAGAAAGAGGGQEE
VDAEAVARSEAHAARFALGQWQSAMDKCKVVWKELQGVPLLPLANGTAGSFPTAFALAGR
KRFVVGTRRQQGLLPKLADRFVHLKATRRLARFFERDDFLEMMGIVRFSPTLLAENLDQV
LPRTWRGEKFVGWGGGSAAGQSGAPKASWLALFWTEVSLLDVASVPGLGSWPLVPITTGE
LVSCSMLQQVVRACPSMLNEVKQRGLGVALAAMERAEKAADERDENELQELLARQAQEAD
PGGEEGDGLEEDDNYDDEDADDDEDDGQEDGRETAAAGGGVGPGDAGAEDELESVLVTVL
RRLGVPVLELAFFPQEQRPWLVVGDPNEASRGALGAIHALKSTLAPPYPISEVCEARRAV
AAEGAEGAAMAAMAEMIASGEDHGRDGRGRKLRLRWGALSPEDMDALLQRQFRQGTGGDL
TSFSLPSGTSDRLLAPSPELSDLIRDIGVEQVDHPGVVARFVLPELGTVPPDDRHKLLHH
VRVHWAELKENQDLVNQFKEVAFIPVNGVPTKASKLFDPRTLVLKEIFGDEPDAFPSGEF
GEEPWLDVLVDIGLKNKLDRDTILQCAKKVESQRTEPLPPAVAERAAVLMRHINSSAGEG
ELYNNDFLSKLSRLRFVPAHLPPPAHAPDDDDDGGVSAFAAEAAGAGGGKGGAGTGDELF
WSLLKIQSPPPLEVVLRHLKIITDRHSQLDRWRYPQTPVKVFQSIFEFLDENWSKLSPGV
TKGLKDRPLVPVGARLIKAGRLFFRLKENLSPFMFEVPRAFGAFDSLFNNLGTTQAPTAS
DYAVFLKELAGECGSQALNPNELGAVLKVLSLLATELEVDATYELSTDIYVPDENSELVP
WGLCLHNDSPSLAGRVDPSRLRCLHPRVSLEDCRRLRIPSVSQVVKEELELGFQPEMVQG
EDSEQAQLSATLSSRELSLAVAVLVKSFSPEDTSVGIGSTDNPDASANAGGGATFEARAN
AAAARLEGFSVVFVKELRSRFLRTGERKDGFRMEEDITAVNGAKGSVFFVRETNKTVLIA
RGVLPGAFPPSYAVALAVTKLVSLPPAAVGPLSVLLATKPDGVESCLSVLQVREGATAGD
ELTRGLPGEPLTPGDKTLLELKPLKAFLPGEVIAWEDKSGGGNSNSPASSLYASTEPPNA
TTTTSSGGGAAVVLRYGVVVIGGSAEAGEGGGDDDDVPGDQRGSGRVGQGLRHVRVKLTP
GRVDALLSTQIYSFRQARAAGATPSSGIVAHAAKMLRRIAGEDKEGGVEEGKSGGGGVGG
GGGGGGGGSGVVSSAQVLDAVNDILGKAELSLSTEQGARLKESLRHKDEARVARVALAKT
SAEADRLKRKLAKVDKAFVCSICCTNDVDVILAPCGHMMCSSCMRSIVRRECPFCRERWT
ATATFRRPGVDEVSDDEDEEDGGR
Download sequence
Identical sequences D8LJG4
Esi0254_0038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]