SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0266_0033 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0266_0033
Domain Number 1 Region: 148-306
Classification Level Classification E-value
Superfamily SIS domain 1.02e-38
Family Phosphoglucose isomerase, PGI 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0266_0033
Sequence length 308
Comment Glucose-6-phosphate isomerase, cytosolic [309] f:218023-222934
Sequence
MGFGHQRDGNSLFGWGGSSSSWGEWATGGTEGGGGGGGGGGGSGGGGGGPDDRRMGWTNK
EWKKFTAGLRGHTDDYDKIWSSWVPFKVDTSGLQEVLKTKTSDLAIKTLAKLQTMAGQED
QAEETLLKLIRDPYNLGDVSWLAKSAAETAEWRRLVVHQKRIKNKHLKDVMALEDRSLAL
SAEFEGTILDYSRMNVSQLTMKLLLDLAKRQNLNKRITAMFEGEKINNTENRAVLHVALR
SHRDDPPIYVDDVDVIQQVHDTLDKVKDFSERVRSGELRGATGKNLVNIVAVGIGGSYLG
PEFVHEVA
Download sequence
Identical sequences D7FU67
Esi0266_0033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]