SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0277_0040 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0277_0040
Domain Number 1 Region: 165-224
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000273
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 56-79
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000131
Family CCCH zinc finger 0.0031
Further Details:      
 
Weak hits

Sequence:  Esi0277_0040
Domain Number - Region: 33-54
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00051
Family CCCH zinc finger 0.0053
Further Details:      
 
Domain Number - Region: 266-281
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0249
Family CCCH zinc finger 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0277_0040
Sequence length 411
Comment conserved unknown protein [412] f:178749-183567
Sequence
MSLCSCSKENSRRINGVTRRLCLYGVLPREHTTTSGKCKFGDSCTFSHDQRDGRLPVCSF
FEKNGSCRYGGDCKFLHGNGGNNGEERPASTTTTTILRAAAAGGSGSGGAGAGAASAQQQ
QEATARAGAKIPTPVAGGARSGDAAAAAAAAAAVVAGEESLADSTEDRCGICLENIPAKG
KRFGLLNCDHVYCLECLRTWRKSKGPQKDISRTCPECRKVSFFLVPSKEHLKGKAKLKAI
QAYKKGLSKLPCKYHKPGKASGGGTTTVCPFGSRCFYAHLDENGNDVKDRATPAPPAPLR
RTCPYLRAGGGGGGGGGGGGGGASRGGGANRGGGRSGGRGGTGAGDRAGHGHGASGRVFS
DVHVLYPFGRDGTTARFAPDIMMGSHGSRQHMSVIMRLQQLMLDAAAAEDL
Download sequence
Identical sequences D8LJX1
Esi0277_0040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]