SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0286_0025 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0286_0025
Domain Number 1 Region: 17-88
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000393
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0286_0025
Sequence length 1677
Comment conserved unknown protein [1678] f:103241-111202
Sequence
MVSLEKESDRQAMENVREFRKGLLCSICNEFLSDTYNLPCGHSFCRECIDDALAERNSCP
DCMNPAWQKDTLKMALTDSTVQDWVANCERLYQAHVARQAARDGESSDTDSDLALVEASS
GDDERGGTDIDEEEEGGGNVAPIAVPSAPPPPPQQQPPARQAAPENEGVVGAAAAAAPSL
PLPAAAEPLPCRSLKGAEKENNAASGSWGAATATSSADLSVAAAAPTAGVVGVERAAAWS
SSPSSSFSGQNRTPRVRFQPSPLRACAAPSEAGQKGSGRQEEEASVHPRREKLPPAAAVT
KPRDSSPLVLEGTVKAGDVVDARLPTEGEKLRSTPAAAPLNRSVANTAAASPPGTESERR
ESTPPRGTLVVTAKDPGPSPSVVPEKPAAVEREEGGSSFAVGLPDTCDIFDAESSPPHSP
IASTTTTTTMLILTPPTLKPGGPETKAAPRVGGTSAEGGTSTDVGVGGGGGGLGGVELGD
SGSEDGVSDAESVPLLGANARLKDVNGQKPQQQQKQQHGSGRTWPSDGVPSPSSRSPLAG
SGVDRPDETTVRHRSTAANDEEGEETCDEADSLSNYGGSGAALGDCGRGEQPTTGVEDER
ANEAVSLEATGPSKDVDPSSSPSRVPLVLTNGGEVPKRPATHGAASGAAEKTSPAKGTGV
VDSVRPGCQAPTASPRHDKLFPDGQRSAAVASKEAELSSTTRVDSPQPVSGSLQRQPQAF
TAPSEASVLHDEQSAAKGDVLARREGRSLDGGELCVAETLPQTPGLGGDVLDKHAVVASP
GDDGDTTVPETSAQGGLATDVLEPNPPKSLAGGVIAGPAGGTPGVEQPEGGGVGEAFEGG
KEDPNVARLEVPDSCVAHADGQEEHHASGGGTASDGLDGRGPVRAEQLGDKNTRGSSVAA
AALAAPQPGVKGGGRTPSSQAAPLQQRRSPENATTRVDSPGLKTGSSADGRLRHDSDEVP
ETLPSQRVGVDAGDGRGSSAAAPDVCLATQELSEQRESTRCSDDHGPELGRRIPETAAQT
STTQEIQSLTTQEVPETAHAWGSVGACGGSSSSRIDGVGSAASGSYSQSEVLETEQLHGG
ATQGTADCAGGVGASGVGDGVEEQGAARFRRGAIAQSQQPQQPPPLQQQQSKSMPPSSST
LPAEAVVGGTSRDEVGGVKSCAGLGDGEKPGEAWASPGSLRADEAAGVHGGVRDGGSPKS
LVPTERTPDGSGNRKRSADYATLSPSSRLSCDPGSAGKRTRLTPPPYSAANPSARPGAAA
SDVEASCNDDKPPDGGSPWQDAGRGSQQGRPIALRGGSGPPGSDDESEMPDTDHDLAAVQ
DAWHAEGGYEFGDDGGYLEDQTEETESGRLPSSPAGDDSPPRKPRKNQEVDNPYAPQAHL
DLSHGGDDFQPAARADGMMSPPVGGVEESGKKPRSSRTAARRPSKSTMGFGSPSFGGAVR
ISPSLSGSRFAASLNDSNRRPIKNRILAAGREHGLGGTTPASLSVPDKSGTWSSFNDLGP
DTEEVENLQARVAEKRAQEKAAAGSAAPETNSFDPSDAEYEEGGESDDDGSWTGRGEQNH
GHRQGWDTRRDSSSENKRKRTAMAAAAAAATTTASEGRGTKVPREARHDRGDDGRPRRRR
SPVLIVLLGCSPREQKRANELCARLGQRRPETELVSGATQRCGWQPVYAASKQQQRW
Download sequence
Identical sequences D7FV25
Esi0286_0025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]