SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0293_0032 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0293_0032
Domain Number 1 Region: 290-463
Classification Level Classification E-value
Superfamily Sec7 domain 8.11e-40
Family Sec7 domain 0.0000718
Further Details:      
 
Domain Number 2 Region: 707-806
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000214
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0293_0032
Sequence length 1364
Comment conserved unknown protein [1364] r:173395-187836
Sequence
MPPLWRVMVLDEFLRWFEVPNSLMEIFLNYDMDRKFTRQWKVFEQMVNILCAIADGRGET
ALGSANVRAEPVDDKAQQTLRLTALRSLAEVMQRLTDAAGHDYVMSGDNKKAKDSTSTAT
TATAAAAASAADGHGEWDTAPSDGTRPSSPSARGGESDGATTDGTPGGGEIFSLPSESRL
LLGQAGVPLRRGDSAHHLDPRSGEFGGAVDSVPGVGLLGGGGGCLPSPGGSVVSYSSTAR
AESILGTSSVSTMSEAGGAAERGGAYNRRRFREPTSFKYCKELRNRAEEVVTEALQLYST
KGLKKAVQHLVASNFISDTPRDIANFLRIYKKDLDPLSIGDFLSEPDVDGGDYWKAIRLQ
YVRAIAFHGMTLEEALRHLLTDSGFRLPGESQKVDRLVSSFAECYVADNRDNPTCPFANA
DTPFILSFAIIMLNTDLHRANAGTGRRRRRRMTKEDFISNLSSLGFEIFLACPLPGSELL
YWSRAASFFYNPKPAFSSRAPSTHLCAARELSKAALGGEELLRALGMFGHRFSLVGVDTG
VSVDLLKLMFQTVSTPVHAVVDSVLDGPEQPDVESVLACIDIVRYALGCSIFLGMTMEKA
AFAKQLPKFCARSLSVRSDSQRAGSGRGGAVMTIGLAGGRGTAEGEAWLEEVEEVENAVE
AKSTIAQVHSLVKSLERRVNDTYLMEELHTVAKRIRNHGSLFDGTPRRFLREGDLIKFTR
TGRKMSYRFFLFSDQLVYAHQLFSGDWKMHEQLLLALVKVVDVQDKKDDSKFCIQHPKKS
FTLSAKTVWNKRAWMTAISEAAEAALRARLETNRLGGVGGATGQASAAAAATTAAAGRGG
PQRPPATAAAAGLRVDTEAANTVAAAAAAAGTNLMAYGVSSSTTSSGSGIAAAVAGSGTP
KEGGGGGGGGGGVAGSLVGGRGGPAGTANSSAFLLLGQGQERQISSDRVTGESAGSEISS
RTESGVGAGTGGDDGSSAGGGGSRPSQRRVAAGGLRGAASPTSSVGSFGGASRELSVVGG
GGGGGGSSSGGTGSKQPGTPLSVGLMSMRSRLLKRWSSTLAGAGTPVSAGGWSYDSGPGS
PNGGSSVAAAAGTGGADQYQKSRLVDGSQLVAPAGGGGGGGDSGLPLSMPPGEPIGVGGD
YGGIGGGDYGATADLPSSWTSLRAGPSHAATSQPQHARTPPEPSAAPPPPPPSFWSRRSS
GTSALGGGAAGIGNEAVPWRSSSGGGGGGGGGGGLPLGSAVHGENVSSSSSLSSSALLHA
RASPSSALLLSSSRGWLTGMNATSVRGSASSASSSTVVRSPIAPTAASAASRQKTRAALH
SAVASGIFHPEASAALSHDNVQGLGVGIDGVGIGMSDGSGSASX
Download sequence
Identical sequences D8LKD8
Esi0293_0032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]