SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0301_0006 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0301_0006
Domain Number 1 Region: 651-746
Classification Level Classification E-value
Superfamily R3H domain 1.86e-16
Family R3H domain 0.004
Further Details:      
 
Weak hits

Sequence:  Esi0301_0006
Domain Number - Region: 172-220
Classification Level Classification E-value
Superfamily RING/U-box 0.000167
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0301_0006
Sequence length 1210
Comment conserved unknown protein [1211] r:13381-30378
Sequence
MPAGGNGAAGTAPLSAAASTFVPSAAAAATTTTTSSAPSARPRSGHPEDDNDTRNGGRGG
RRAKANNDCRRKTGRRNGGGDGATAPPHTDGEDTQAELQQGSNSNPSKRGGSKRGGRSGS
KGRGGGRGRGDRGNAARNRNPNSSSRGAGRGGGGGGGGSGSGAVDQEEEGGRPLCIVCAN
EMEYFAVGECNHPGRCSTCAMRSRVLLKDRSCPECKTVQDRLVVAELPASGDAPRFETFN
LWGDFAGPDSVFDDESGMVFYACRGHYDDLLRMRDPYCPVAGCKGAAAGGREGGKGCGVG
GHELFPNIGALMEHMKGFHQRFLCQLCLEGRPLFLSEQEVFTASGLRKHEAKVEGGHPLC
RFCNKRYFRGEPQLRDHLRTSHFLCDRGACRQRGVVSAFNTPSGFQAHLLEDHGITDRRA
ASAGGVGFNVRRAARDGTGLHTSYNSVADATTPTAPGESLAAPDPELDLAGGVVVPVPLT
RGRESTVPSPGTTPAGRTRNLPSGGGSTAADPLQEAFPSLPTAPPRSSGGSGAGGAGGAR
QERHALSLVGKNIRPDHQRRGGGRAGGGAPTDSSVSSRGRGGGGHGSEEEEKEKRQLLRN
KRLADALGIRAALGAGAAIGGAKVGTTASGATVAMGIGDGLDAIREHLTRTNYSTYLVSW
ARANRAELGKLERRLAELVSDPKGTSSQLKPMPSLDRKAAHELAAHYGLVTQSYDLEPKR
YVSVIKQKGCRLPTRLLSSAARDPSYTGTDEVPATEGGGAAPVKPALERTTTNPNPRATS
LLGPASTPSGGKGSDHPPPEAAPSLGGGGGPRTSTVTSISSADPLAVDPVAAAEAAAAAA
NNAKADGKKTYFQRSKRRGVPPPSSSARPATATAAPAVKAATVLAEPSRQDRDEKEDAAA
AEEELKGPENSNDSVPGKPKKSGSASGSGSLPEAVKSAAGAPSGDGGRNRGNGAGPGGAA
AVGPDNPECLLVFHSVKAGLGGGDAVLASVRTLVPARTVVGVRPATATEVSVAGVQGHRG
GGSSVGSTLVMEFSSALNARRAWEEVEKEAEQLVAAARVTRTDHHAPFRAKLYPSAPPVD
DGGGSGGSGGGGGLVDVVRDNWDDSSEDEDEEPVDGARDSVRDEGGDDETERNEEPRLQD
SHEDEDQAQGEAALQVGQLGDQGETLATFRRSGDDGGAGGGRPPRTPREAEAYGGSTARE
PAEEGPGQES
Download sequence
Identical sequences D8LKN7
Esi0301_0006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]