SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0308_0009 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0308_0009
Domain Number 1 Region: 116-163
Classification Level Classification E-value
Superfamily RING/U-box 0.000000389
Family RING finger domain, C3HC4 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0308_0009
Sequence length 168
Comment Pc21g14320 [169] r:52554-53707
Sequence
MQFLRSSLSDSSAGGDGRGAAATAAAAASSLHQRHVDNAGAGASGASPYPAANNAANSGA
PAPGLAPLATVSSAGTTASAAAAAASGVGGDDDSDRSATRKPADGNGGGDGDGRRQEEER
CKICHMGSVDALLLPCGHLCACHSCASVLVVCPICRADIYRVQPVYRS
Download sequence
Identical sequences D7FWL2
Esi0308_0009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]