SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0334_0031 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0334_0031
Domain Number 1 Region: 115-157
Classification Level Classification E-value
Superfamily RING/U-box 0.00000466
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0334_0031
Sequence length 161
Comment RING Zn finger-containing protein [162] f:166508-169913
Sequence
MALAGVTDDVHSGGAGGKETESLQPVDDSDRHDGGAHSSDGTTDPIPADISTTDAVAKET
EYLSEPARRWTKLRQNFRLAALRSIAQDKREALKKLQEVRKRADKAQEAQSDSRTCKICW
DRATNTVCLDCGHQCMCTRCGACMTFCPICMQDITDLVELQ
Download sequence
Identical sequences D7FXX5
Esi0334_0031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]