SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0338_0003 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0338_0003
Domain Number 1 Region: 149-202
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-20
Family RING finger domain, C3HC4 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0338_0003
Sequence length 203
Comment ring finger protein [204] r:20046-25591
Sequence
MMLASPAASGEASAEASAATVEGTAVPSVGDAEAESLALARQLMEEEAMASYAAAVDNFR
SAAAAARAAGGGMEGVAPEDMAAMQALMEEDENNPDAFAMAEDESLDYDGMLELGSAIGD
VRKDRWRMRCKSVIAALPRVSYTAGGYSGGEDTKCLVCQCDYEEDDELRILPCSHTFHTE
CVDGWLEENEECPTCRRSVSPQA
Download sequence
Identical sequences D7FY13
Esi0338_0003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]