SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0340_0028 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0340_0028
Domain Number 1 Region: 363-410
Classification Level Classification E-value
Superfamily RING/U-box 0.000000133
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0340_0028
Sequence length 417
Comment putative RING finger protein [418] r:166775-176901
Sequence
MEPNNNANTKPTGGRSPAGVYGVLAEPAELSVMRVNQLDAGVLDTELHSLLKTQLGRACS
GLPAGTLERFKPEVDALFNLLMFRFTVWVHRPTPGMHLQGLRYRSERGRTAGAPSATATG
GSAAAAAAGGSSPLASGWEGGEGGALGHGGPSNTPEGGASSTSTFPGLASTAPLPCWGDA
APTRAQRLVHGLLSVGVQWGFARLRRHGLVHGWGGEDAGSVRRVAWHVLGRLETLFRLAW
MVNLLLFLKSGKYATPVDRLVRMRMVHDRADPGPRPINYQFLNRRLLWDHWAKMAYVVAP
LINWGSVRRAVSGGAGRLRREARALGIFGGSSGGSGRVSARGLGADAAPATEAAAAELVL
TACAECGANPAKTPYVTGCGHVFCYYCARVACTVDPRYTCPRCGEYFATSRRWSQPR
Download sequence
Identical sequences D8LL84
Esi0340_0028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]