SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0342_0012 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0342_0012
Domain Number 1 Region: 14-84
Classification Level Classification E-value
Superfamily RING/U-box 0.000000243
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0342_0012
Sequence length 99
Comment conserved unknown protein [100] r:60026-62887
Sequence
MSTMDLEIAAGYGECSVCFEHLCAKGASVMVDGSGQQAGFLRAERLPRRVCRHFLCQECA
PTIIPRKCPVCRRDFVSTLDVPDPITDPVRWFHVVDRDQ
Download sequence
Identical sequences D7FYD8
Esi0342_0012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]