SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0343_0004 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0343_0004
Domain Number 1 Region: 510-584
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 849-892
Classification Level Classification E-value
Superfamily RING/U-box 0.000083
Family RING finger domain, C3HC4 0.048
Further Details:      
 
Weak hits

Sequence:  Esi0343_0004
Domain Number - Region: 587-677
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00895
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0343_0004
Sequence length 898
Comment conserved unknown protein [899] r:12402-23115
Sequence
MPPHTPPVLPPALLLLREDLGYVPYDRAAVRSATDSGGGDTSSGTGGWTDGSPAGSSISG
GGGGGGGGGGVYGLSSAGGAAGATVGKRKGFGRFKVFGAMKSLLRPQADVERAKNGGGNS
STERGTPTPPFAISPAPSFSPTNPGGVRVVASGGGGGGGGGGRGGGGGGEGRTAAQEAAL
AALLSGEHEGLFREEKVEGDYQGDGEEKSCRPSWLEGRREEDKKGEEEKSCRPNWLEGRG
QEDTRWLGGGRECKQPGEGVEESKSSFFLLPRAPGGSTAERTVPPPVSTNRIRPRQLPST
EEGQAPSPLLAGGSGSRDAEAMAAAMAAAMEAAATEGAPATSAARQRGKGWRTKIKRRSR
RRDQEPEGDFAAAGTEAGAAESQGPSPILSPAAAGGGEAAAEAAAPAGLTALGLSPGTAE
RGGKRSLRGEGSGASEEEAAVARLTEMSRAAQPVRELTPHLVEELDGGGGGFTLTVFKYN
KQDQVPTPLVCGKFATSYEADRAAEAFSSPVWHEPTPNSTCAECQSVFRPVLQRRRHHCR
NCGRLVCTTCALRFWPKHMLPHSYRTSSTERRVRVCRTCYSVGKAFRRALLRGSYQGAME
AHGTGCVNLRAPFSDRELPVHCAAAGGNVSLMMWLLEDRCCPIFMDDEKTMPHLDGAGRS
VMAAAADSGRVEMMRYLTFTQPSAASGMGMAPFWRGLQACLRNDEDKHDDDRGRGRDRAP
LEGTSHPEPKGRGGSRDAGGGDDGGKSCYPVGSSADRNPAWRSNAPGSAVGGGNGSGGVE
GCDTFLAGMRAGAGGGGGGSGTGDRDPLQAALEMSVVEAGYSIYELTTGKDGSGGDDGGG
GGGMKGKNACIVCFDRPVNCTFVPCGHHCCCMPCAESKLNLCPVCGVAIDKKIKTISA
Download sequence
Identical sequences D7FYF4
Esi0343_0004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]