SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0425_0011 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Esi0425_0011
Domain Number - Region: 115-188
Classification Level Classification E-value
Superfamily PWI domain 0.0301
Family PWI domain 0.0065
Further Details:      
 
Domain Number - Region: 2-20
Classification Level Classification E-value
Superfamily RING/U-box 0.0918
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0425_0011
Sequence length 209
Comment hypothetical protein [210] r:42054-43875
Sequence
MQWLKASDRCPLCKVTVSRVLHEIKSPKDYEIYTHVSVKKRGGGGAEGSLPSPPAAGGTA
AETSGRVGGGDEGARASGGAAVVDGRTGPEFRSLVYRRGLAAEPPAEKARRPKPLDQLRS
WIARDVQAAAPGTRGGGGMDTRLVEDIVRALLKDNDVDTQDGYCTVKEQGFLFENTAPFL
HELWCFRWSKARMPAYDRRAVYRPRPTQR
Download sequence
Identical sequences D7G117
Esi0425_0011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]