SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0456_0012 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0456_0012
Domain Number 1 Region: 1063-1343
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-58
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 46-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.48e-31
Family Ankyrin repeat 0.00072
Further Details:      
 
Domain Number 3 Region: 1495-1540
Classification Level Classification E-value
Superfamily RING/U-box 0.0000263
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0456_0012
Sequence length 1554
Comment serine/threonine-specific protein kinase-like protein [1555] f:42957-59300
Sequence
MPGATAAGSPSKYITAALADLFSCIGGGDIVSAKALLEGKHKNDKEAILSATNPAGITLL
QHACHSGQAGGVNMLLEKGADPNWTSTKGSTPLHFACNNGHFDCAEALLRAGVDVDAGNA
NGTTPLIIAAFGAHASCVRLLLEHDADPNVRDKLGRRAGDSLCGTINAVSGRVGVGVGGG
SGSAAGGGGAATMSSGGATQGTKAENEPFSETRSLLAVARTQRSTRRGRSDSTASSSTTS
TACVDVKSRGAVGGSAVGGNAICTHGGTAGVVCASAGAGSAGHVDPGPDGLERSPTLATA
AEGTGKDARLPSAKLPPPSSLVAGKPSGDMVGHSSCSGSTGTSTSVSGNGNGNGSAGSGS
ACNRAAQTTIPLPPANTAELDSVPSVLAAAAAAAAAASRPTPTAAGAASFSGEATPPTLA
NSPRTTPMPSPAPSPRRASKLLSSSSVLSPQLQQSQLPSRGSSTPTFPSPLAASAATDPE
LDHPGLQSKRSADLKAALAANAAMIRSMQEEERAFSVQRDLLERRRGEAGARRKGAEEHA
ALLRAQAGELARKDAPGTPLMPVMVGGGANTPASARGDAGSGRSPEPPPALMPPSPVSDS
NNNASSVFDTPTSGAAAGEEARKALPEARSGATAPRAASSSSGCSPRCVPAYGPAAVAAV
AAVAMSAWEGTTVTPAVSAADLNRTPVSPPPPASSSITITTDKTTITITITISDTRSPRI
PTLRWWKWAGMAVAAAGCRGSRTLVEVFQWKAESMDQAATLARARRRCWRHRDGRSQRSR
TNANKRQRAGTTSLSSQRLQHSDAATDGARGIHHGHMEGGSQCFSPRGTIRITDVATSSP
SSSSSLSDPMSPGLRSEVRRLRAEAAARGREHASLAAQHASLVLEKARQAGVLRNRVASA
DGEVERLSRKLREAQEKLEAQAREAEALRRQAEGQQGLLHSRSHVLEQALGRLENIGVAL
AEERSLNSARSRDNGQGNGGGGDAPNAVGGGSDADGPANANGDREEEGCEEDGGAGSVPM
RDVGVEENEAAAGAAAGAPAASAMAAGAGERPEDRPQGGLEMARIFSHQQIDAACAGFPD
SAIVGRGGFGPVFRGRFMGEDVAVKRLDGYGLQGLPNFLKEVQVLTTCRHEHLVPLLGIC
VDPTPMLVYPFVGQSLEWHLREPQRRAAIGWRTRLSVALSISKGLQYLHQPQAGAWGKPV
IVHRDVKTENILMDSNLRARLSDVGIARQLDGAGSEASTRLIGTWGYIDPEYQETGVLTP
ASDVYSLGVVFLELLTGLPAHSAQLRPSCLVDRVNGKQLSDCLDSACSWPDTPPVVSFAK
EAWQCVSRQGDGRPRLQHLIERMERLDLGDDAGGGAGTAAAANSDSSGAGPAESAPNASV
LASPLPPPTPASSTALPPGVVAGPTMPGSSIAASAAAVAAASAAATAARAATEAAAAAAA
AVASGASSLMPPQPQPAVPPSPPSPAMADAAVGGAVAGATSSPMAAPSPSPEAGRDCMIC
ASAPVQTRFLPCRHSLACTSCASLLRARGDRCPVDRARIIGLETGQFQVTYTGD
Download sequence
Identical sequences D7G1Q5
Esi0456_0012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]