SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0626_0005 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0626_0005
Domain Number 1 Region: 15-284
Classification Level Classification E-value
Superfamily SIS domain 6.67e-91
Family Phosphoglucose isomerase, PGI 0.000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0626_0005
Sequence length 305
Comment cytosolic glucose-6-phosphate isomerase [306] r:22607-34105
Sequence
MGEDPKVAMKHLAACASESASERVTAFGIPKDRLFPLWDWVGGRYSVCSSVGALPLSLKY
GFQQFDSFLAGARSMDRHFLHAPLEKNMPVLMGLLGVWNISFMGYKTRTILPYAEALLKF
PAHIQQLAMESNGKRVTRKGDKVSYDIGQVDFGEPGTNGQHSFFQLLHMGQVCPAEFIGF
IESQNPLHIKGEPICSHDELMANFFAQVNAYHLGQILALYEHRTAVEGFMWDINSFDQWG
VELGKSLATDIREKMQRFRSPEQEAPSGLNPSTYRLMSRYLQQSDSLIKKGGNINHRSKV
IKKDP
Download sequence
Identical sequences D7G558
Esi0626_0005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]