SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0850_0001 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0850_0001
Domain Number 1 Region: 47-125,394-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-57
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 2 Region: 238-293
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000205
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0850_0001
Sequence length 573
Comment conserved unknown protein [574] r:2468-9131
Sequence
MLFCRTQRLPPDSTYSWHIRTGYVGEGKKAFLRLKREVLDMILLRRTKSNRSNDICLPPR
IVRVRQHRLDEREEDFYQALYTQSQAQFDTYVGSGTILNNYAHIFDILIRLRQAVDHPYL
VIYSATKREGMTPAMNSAAGQNPTPAPAPPAETTPRGSQSRTSRSSTAQANGAATPNGGR
SSRSSSSRTATAGTRADNLGDTSSDSESSDAEGGGKAAGAQNGAGAGGRAGAQEYDSDEE
EESDLCGICREPAERLVSSSCGHSFCRTCVQELIDAAPGDVECPTCSQPLTVDLSGGSPG
AEGDDDDQEAAQRSSGGGRGRGRGRGGAAARGRSRSGGGGGGGGGAAKSRVAGAMAALEA
SMKKKKTQTMKPAASGGGGVKRSVTKHSVINRIDLNKFQSSTKMEALMEEVHLMMERDPA
AKAIVFSQFVNMLDLIEFRMHKGQVGCRKLSGHLSVDKREEVLQAFQTDPGVKVLLISLK
AGGVALNLTVANHIFLMDPWWNPAAEMQAIDRTHRLGQFKPIYATRFIIEDTVEERIIKL
QEKKQLVFDSTVGGDAASTGKLTVDDLRFLFAH
Download sequence
Identical sequences D7G7X0
Esi0850_0001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]