SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0010_0200 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0010_0200
Domain Number 1 Region: 66-136
Classification Level Classification E-value
Superfamily RING/U-box 1.3e-18
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0010_0200
Sequence length 139
Comment conserved unknown protein [140] f:1112766-1113972
Sequence
MTTCPVCGEQVQADLCSLHLDTDCSGGGRKEEVRDEVGSGNGGEADSGKTVPKRDTGSEA
AGGLNALAAELTCPICLCVFEDAHSLPCSHRFCLECILGCFKSSKRQECPLCKIPAWKRD
LTRDVSIQNIIAAYRRMAA
Download sequence
Identical sequences D8LC67
Esi0010_0200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]