SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0123_0077 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0123_0077
Domain Number 1 Region: 329-377
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-16
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0123_0077
Sequence length 389
Comment conserved unknown protein [390] f:427435-428907
Sequence
MGIFNYARQLELGAKGAKEIESPNGRLYLRRDSDGSQPYGEEEKDFRVGELHPDSALSSS
HASPTHLCDGSSAVPGRREREVAFPRGRRQKEKKNDACYDPVANSRTETAVPPTDGVTAC
ASGHERPERAGGERGTCGGDSNPIETERNELQMLPRRDGGWTEEKKEQDGEGHAICDGGG
AADRQGTREQLASAAEGKARDGEDVVRSRDENGALHELGANNGDTTGQGPNEVRNASTSD
IAAGAPAPADAAPAVTVVEAEQPDAGGVETNSVVASGSEAAVVAMAVRPPGVPCRPGSLR
LLSDKRLSEARNRRGGMFPACRPPRGGSSVACPVCLEAFQAQDVVTLVTCGHAFHRSCIE
RWLERSARCPCCRWSLAWTNRGCCPRMGI
Download sequence
Identical sequences D7FIT8
Esi0123_0077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]