SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0155_0048 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0155_0048
Domain Number 1 Region: 188-232
Classification Level Classification E-value
Superfamily RING/U-box 2.66e-19
Family RING finger domain, C3HC4 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0155_0048
Sequence length 235
Comment protein binding / ubiquitin-protein ligase/ zinc ion binding [236] f:273088-276742
Sequence
MSEGADGGNASLSNAEEGRAATISPPDTASRRSAGPLRASLITLRSRRFVGLLLMICVFS
LVQVGVLNWALVAWGFFGSLLVVSFFRLVRLVNGYAIRSNTARRRRQRIPRGALEARLQL
HHPGIELGRLRLLLVDRDFTGEDYQALLDLDDNNDVPSTVGASEGEIRRNPSFVIPEPAA
DSVVKPKNCSICLYPFKPRERVRIIPCLHQFHTECIDPWLRQNAICPVCKFPAVG
Download sequence
Identical sequences D8LG18
Esi0155_0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]