SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0196_0048 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0196_0048
Domain Number 1 Region: 437-565
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.79e-27
Family Chaperone J-domain 0.00013
Further Details:      
 
Domain Number 2 Region: 8-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000331
Family DIX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Esi0196_0048
Sequence length 568
Comment conserved unknown protein [569] r:238034-245886
Sequence
MAGKGGMWVFYFLQGEDGDSVENPNAFNIMGAVSEVRLGQFLQAFPLRGHGGQYHFRFRA
PDQVSGYCWMDVSDPSAVLPRYGNVICAKALRLDRLPKPRSSRLRRKMPYAAGAATTSGG
DHLRASGGANSRFTEEAHRRRSAQDYPGNARHHGGQPQQPQQPRQQQQWSNQGRPRSVSP
AHGHQIHHDDVNKGKSVTPPPSHGGGGSKGAPMSRGPPPQSPPPPPPENLEEFLFSDSPT
GSPRASPRAQGGGIAHSSTPRGGGSNSGSNNSKDREAGGEGRSGEDLLNFGNDSGGGRPK
QAPEPSPRPTTNGGRSPVPAGWGNRPAAARGSPVAGGAGSSNGGASPQGRKSTAGRMQGA
AAGRTNGGGSRGPTGAPVNNGRSNSGGKSVSGAGGGAGATGPPGFLMNFNSPRAGGGAAA
AGAGGQSAYVKTKVQEREEELKANVEKALEFKKGIDEAASKDQDAMDAAKVKHDAKLTSW
AEDHGKKRNVRTLLSTMHLVLWEGNRWKSVSMGDIIQPSKVKLSYRKAMLLVHPDKCGSL
GPEERLIAKRVFEAVNEAYTLFQEKEMS
Download sequence
Identical sequences D8LHK2
Esi0196_0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]